DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4854 and Zfp239

DIOPT Version :9

Sequence 1:	NP_650860.1	Gene:	CG4854 / 42391	FlyBaseID:	FBgn0038766	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	XP_008761490.2	Gene:	Zfp239 / 100909657	RGDID:	6502210	Length:	201	Species:	Rattus norvegicus

Alignment Length:	139	Identity:	58/139 - (41%)
Similarity:	77/139 - (55%)	Gaps:	0/139 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   178 FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSR 242
            |.|:.|...:|:..||..|.:||:.:||:|||.|...|.|...|..|...|||.|||||..|...
  Rat    34 FKCDRCGKGFSQSSKLHIHQRVHTGEKPYECEECGMSFSQRSNLHIHQRVHTGERPYKCGECGKG 98

  Fly   243 FADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNS 307
            |:..|....|:..||.|:||:|..|.:.|..|:.||:||:.||||:|:.|..|.|.|||......
  Rat    99 FSQSSNLHIHRCTHTGEKPYQCYECGKGFSQSSDLRIHLRVHTGEKPYHCGKCGKGFSQSSKLLI 163

  Fly   308 HEKSHKRTK 316
            |::.|...|
  Rat   164 HQRVHTGEK 172

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4854	NP_650860.1	zf-AD	12..>57	CDD:285071
		C2H2 Zn finger	180..200	CDD:275368	6/19 (32%)
		zf-H2C2_2	193..217	CDD:290200	11/23 (48%)
		COG5048	201..>258	CDD:227381	23/56 (41%)
		C2H2 Zn finger	208..228	CDD:275368	7/19 (37%)
		zf-H2C2_2	221..244	CDD:290200	11/22 (50%)
		C2H2 Zn finger	236..256	CDD:275368	5/19 (26%)
		zf-H2C2_2	251..273	CDD:290200	9/21 (43%)
		C2H2 Zn finger	264..284	CDD:275368	8/19 (42%)
		zf-H2C2_2	277..301	CDD:290200	13/23 (57%)
		C2H2 Zn finger	292..312	CDD:275368	7/19 (37%)
Zfp239	XP_008761490.2	COG5048	<4..164	CDD:227381	55/129 (43%)
		C2H2 Zn finger	8..28	CDD:275368
		C2H2 Zn finger	36..56	CDD:275368	6/19 (32%)
		C2H2 Zn finger	64..84	CDD:275368	7/19 (37%)
		C2H2 Zn finger	92..112	CDD:275368	5/19 (26%)
		C2H2 Zn finger	120..140	CDD:275368	8/19 (42%)
		COG5048	144..>201	CDD:227381	10/29 (34%)
		C2H2 Zn finger	148..168	CDD:275368	7/19 (37%)
		C2H2 Zn finger	176..196	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	139	1.000	Inparanoid score	I4420
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.050