DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and ZNF730

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_016881603.1 Gene:ZNF730 / 100129543 HGNCID:32470 Length:514 Species:Homo sapiens


Alignment Length:294 Identity:75/294 - (25%)
Similarity:131/294 - (44%) Gaps:45/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LCQQTEKDL-KEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTLESS 133
            :|....:|| .||.:::...|::. .|..|.:.|:..|.|......:.::..:..:.::..|.:|
Human    88 ICSHIAQDLWPEQGIKDYFQEVIL-RQYKKCRHENLLLRKGCKNVDEFKMHKKGYNRHNQCLTTS 151

  Fly   134 EDVACSADELVSIEPAIS-APEESVYSLSPKPV--------------------------TFEDED 171
            .......|:.|.:....| :....:...|.||.                          :::.|:
Human   152 HSKIFQCDKYVKVFHKFSNSNRHKIRHTSKKPFKCKECGKLFCILSHLAQHKKIHTGEKSYKCEE 216

  Fly   172 SGQAAS----------------FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQ 220
            .|:|.:                :.|..|...::.....|.|.::|:.:||::||.|.|.|.|:..
Human   217 YGKAFNESSNCTTHKRITEKKPYKCKECGKAFNWFSHFTTHKRIHTGEKPYQCEKCGKFFNQSTN 281

  Fly   221 LARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHT 285
            |..|...|||.:||||:.|...|...|...:|::|||.|:|||||.|.::|.:|:.|..|.:.|.
Human   282 LTTHKRIHTGEKPYKCEECGKAFNQSSNLTEHKKIHTKEQPYKCEKCGKAFKWSSTLTKHKRIHN 346

  Fly   286 GERPFSCQYCQKSFSQLHHKNSHEKSHKRTKEVK 319
            ||:|:.|:.|.|:|::....|.|:.:|...|..|
Human   347 GEKPYKCEECGKAFNRSSTLNRHKITHTGGKPYK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 4/19 (21%)
zf-H2C2_2 193..217 CDD:290200 10/23 (43%)
COG5048 201..>258 CDD:227381 23/56 (41%)
C2H2 Zn finger 208..228 CDD:275368 8/19 (42%)
zf-H2C2_2 221..244 CDD:290200 10/22 (45%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 251..273 CDD:290200 12/21 (57%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
ZNF730XP_016881603.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.