| Sequence 1: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001106205.1 | Gene: | ZSCAN30 / 100101467 | HGNCID: | 33517 | Length: | 494 | Species: | Homo sapiens |
| Alignment Length: | 225 | Identity: | 70/225 - (31%) |
|---|---|---|---|
| Similarity: | 109/225 - (48%) | Gaps: | 34/225 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 101 TESRDLSKNEATGSDSELEYEYLDSYDVTLESSEDVACSADELVSIEPAISAPEESVYSL----- 160
Fly 161 ----SPKPVTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQL 221
Fly 222 ARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTG 286
Fly 287 ERPFSCQYCQKSFSQLHHKNSHEKSHKRTK 316 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | |
| C2H2 Zn finger | 180..200 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 193..217 | CDD:290200 | 11/23 (48%) | ||
| COG5048 | 201..>258 | CDD:227381 | 25/56 (45%) | ||
| C2H2 Zn finger | 208..228 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 221..244 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 251..273 | CDD:290200 | 8/21 (38%) | ||
| C2H2 Zn finger | 264..284 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 277..301 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 292..312 | CDD:275368 | 7/19 (37%) | ||
| ZSCAN30 | NP_001106205.1 | SCAN | 44..154 | CDD:128708 | |
| SCAN | 44..122 | CDD:280241 | |||
| COG5048 | 281..>360 | CDD:227381 | 21/103 (20%) | ||
| zf-C2H2 | 301..323 | CDD:278523 | 3/21 (14%) | ||
| C2H2 Zn finger | 303..323 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 316..339 | CDD:290200 | 3/23 (13%) | ||
| COG5048 | <328..479 | CDD:227381 | 54/140 (39%) | ||
| C2H2 Zn finger | 331..351 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 343..366 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 359..379 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 371..396 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 387..407 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 399..424 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 415..435 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 428..452 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 443..463 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 455..480 | CDD:290200 | 3/13 (23%) | ||
| C2H2 Zn finger | 471..491 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||