DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and DOT5

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_172787.1	Gene:	DOT5 / 837889	AraportID:	AT1G13290	Length:	302	Species:	Arabidopsis thaliana

Alignment Length:	137	Identity:	31/137 - (22%)
Similarity:	49/137 - (35%)	Gaps:	41/137 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   189 CAICGNGYPRKSTLDTHMRRHNDERPYE-------------------CEICHKSFHVNYQ----- 229
            |::|...:.|.:.:..||..|..:  |.                   |..|.:....|..
plant   103 CSVCNKTFNRFNNMQMHMWGHGSQ--YRKGPESLRGTKSSSSILRLPCYCCAEGCKNNIDHPRSK 165

  Fly   230 -------LKRHIRQHTGAKPYTC-QYCQRNFADRTSLVKHERTHRNE--RPYACKTCGKKFTYAS 284
                   |:.|.::..||||:.| :.|::.||.|...    |||...  :.:.| .||..|.:..
plant   166 PLKDFRTLQTHYKRKHGAKPFRCRKKCEKTFAVRGDW----RTHEKNCGKLWFC-VCGSDFKHKR 225

  Fly   285 VLKMHYK 291
            .||.|.:
plant   226 SLKDHVR 232

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	5/19 (26%)
		DUF45	<204..281	CDD:302795	24/110 (22%)
		COG5048	210..>345	CDD:227381	25/116 (22%)
		C2H2 Zn finger	217..237	CDD:275368	5/31 (16%)
		C2H2 Zn finger	245..265	CDD:275368	6/20 (30%)
		zf-H2C2_2	257..282	CDD:290200	7/26 (27%)
		C2H2 Zn finger	273..293	CDD:275368	7/19 (37%)
		zf-H2C2_2	286..310	CDD:290200	3/6 (50%)
		C2H2 Zn finger	301..320	CDD:275368
DOT5	NP_172787.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	62	1.000	Inparanoid score	I2531
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.050