Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001103786.2 | Gene: | Zscan4f / 665902 | MGIID: | 3708485 | Length: | 506 | Species: | Mus musculus |
Alignment Length: | 262 | Identity: | 63/262 - (24%) |
---|---|---|---|
Similarity: | 100/262 - (38%) | Gaps: | 51/262 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 PSTPPPIETEQLEPPED---EVLEEG----------------------------------VWSTE 139
Fly 140 DPIEETPHG-PAEKERPTVLTVEMLPAPYPPPASTPPPAPAGAVKGK----LHVCAICGNGYPRK 199
Fly 200 STLDTHMRRH-NDERPYECEICHKSFHVNYQLKRHIRQHTGAK-PYTCQYCQRNF---ADRTSLV 259
Fly 260 KHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHI 324
Fly 325 ND 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
C2H2 Zn finger | 189..209 | CDD:275368 | 2/19 (11%) | ||
DUF45 | <204..281 | CDD:302795 | 28/81 (35%) | ||
COG5048 | 210..>345 | CDD:227381 | 43/121 (36%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 8/22 (36%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 301..320 | CDD:275368 | 6/18 (33%) | ||
Zscan4f | NP_001103786.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
SCAN | <51..117 | CDD:295388 | |||
zf-C2H2 | 395..417 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 397..417 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 8/22 (36%) | ||
zf-H2C2_2 | 438..463 | CDD:290200 | 12/27 (44%) | ||
C2H2 Zn finger | 454..474 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 466..491 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 482..500 | CDD:275368 | 5/17 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |