| Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001093656.1 | Gene: | Zscan4d / 545913 | MGIID: | 3645954 | Length: | 506 | Species: | Mus musculus |
| Alignment Length: | 254 | Identity: | 64/254 - (25%) |
|---|---|---|---|
| Similarity: | 97/254 - (38%) | Gaps: | 70/254 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 108 QQTRPSTPPPIETEQL---------EPPEDEV------------------LEEGV---WSTEDPI 142
Fly 143 EETPHGPAEKERPTVLTVEMLPAPYPPPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMR 207
Fly 208 R-HNDERPYECEICHKSFHVNYQLKRHIRQHTGAK-PYTCQYCQRNF---ADRTSLVKHERTHRN 267
Fly 268 ERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHIND 326 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
| C2H2 Zn finger | 189..209 | CDD:275368 | 3/20 (15%) | ||
| DUF45 | <204..281 | CDD:302795 | 27/81 (33%) | ||
| COG5048 | 210..>345 | CDD:227381 | 42/121 (35%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 8/22 (36%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 301..320 | CDD:275368 | 6/18 (33%) | ||
| Zscan4d | NP_001093656.1 | SCAN | <51..117 | CDD:295388 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 238..264 | ||||
| zf-C2H2 | 395..417 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 397..417 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 426..446 | CDD:275368 | 8/22 (36%) | ||
| zf-H2C2_2 | 438..463 | CDD:290200 | 12/27 (44%) | ||
| C2H2 Zn finger | 454..474 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 466..491 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 482..500 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||