| Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001037792.1 | Gene: | zgc:101130 / 445160 | ZFINID: | ZDB-GENE-040801-72 | Length: | 372 | Species: | Danio rerio |
| Alignment Length: | 220 | Identity: | 82/220 - (37%) |
|---|---|---|---|
| Similarity: | 110/220 - (50%) | Gaps: | 39/220 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 140 DPIEETPHGPAE-------KERPTVLTVEMLPAPYPP---------PASTPPPAPAGAVKGKLHV 188
Fly 189 CAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNFA 253
Fly 254 DRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHL 318
Fly 319 ---------------QTQQHINDPR 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
| C2H2 Zn finger | 189..209 | CDD:275368 | 9/19 (47%) | ||
| DUF45 | <204..281 | CDD:302795 | 34/76 (45%) | ||
| COG5048 | 210..>345 | CDD:227381 | 53/134 (40%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 14/23 (61%) | ||
| C2H2 Zn finger | 301..320 | CDD:275368 | 7/33 (21%) | ||
| zgc:101130 | NP_001037792.1 | COG5048 | 43..>334 | CDD:227381 | 69/175 (39%) |
| C2H2 Zn finger | 59..79 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 72..96 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 87..107 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 115..135 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 128..152 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 143..163 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 171..191 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 199..219 | CDD:275368 | 3/15 (20%) | ||
| C2H2 Zn finger | 227..247 | CDD:275368 | |||
| zf-H2C2_2 | 239..264 | CDD:290200 | |||
| C2H2 Zn finger | 255..275 | CDD:275368 | |||
| C2H2 Zn finger | 283..303 | CDD:275368 | |||
| zf-H2C2_2 | 296..320 | CDD:290200 | |||
| C2H2 Zn finger | 311..331 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||