DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and CG1792

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:373 Identity:99/373 - (26%)
Similarity:157/373 - (42%) Gaps:85/373 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CRTCLQDGEAHMVSIFQTADDRL---PGGVSLCDKIESLSGIQIRATAKEEVLPTRICLRCKAFL 72
            ||||       .:.||.:....|   |..|.| .:||.|:|:.:......| ||..||..|:..|
  Fly     6 CRTC-------GLFIFCSTPSNLFEEPNSVML-HQIEVLTGLFLLGGPGNE-LPPFICSPCELDL 61

  Fly    73 TLAHKFRQICQRSNEFLRE------YVIKDAVEQGVVKEVVQQTRPSTPPPIETEQLE-PPEDEV 130
            ..|..||:...|:.:.|:|      ..:.::...||.|| :|.....|    |.|.:: .||:.:
  Fly    62 QTAIAFRERVIRTQKTLQESPNLGNAELIESFAVGVEKE-IQYAEEVT----EIEVIDLLPEEHL 121

  Fly   131 LEEGVWSTEDPIE-----ETPH--GPAEKER--------PTVLTV-------------------- 160
            |||    ||:|.|     |.|.  .||::::        |||.|.                    
  Fly   122 LEE----TEEPYEICEQNEQPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTED 182

  Fly   161 EMLPAPYPPPASTPPPAPAGAVKGKLH----VCAICGNGYPRKSTLDTHMRRHNDERPYECEICH 221
            |::                 |:|.:..    :|..||..:...|....|:.||...:.:.|:.|.
  Fly   183 EVV-----------------ALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCS 230

  Fly   222 KSFHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHER-THRNERPYACKTCGKKFTYASV 285
            :.|:....|:||...|.|...:.|:||:..:::.:..::||| .|.|.:|:.||.|.|.|..:..
  Fly   231 QQFYTATLLRRHQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGK 295

  Fly   286 LKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHINDPRLTAYL 333
            |:.|..:|||.:...|..|..||.|..:|.:|.:::.|.:.....|.|
  Fly   296 LRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAAL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 27/89 (30%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
DUF45 <204..281 CDD:302795 24/77 (31%)
COG5048 210..>345 CDD:227381 37/125 (30%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 245..265 CDD:275368 6/20 (30%)
zf-H2C2_2 257..282 CDD:290200 11/25 (44%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 9/23 (39%)
C2H2 Zn finger 301..320 CDD:275368 7/18 (39%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 26/82 (32%)
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 6/20 (30%)
zf-C2H2 281..303 CDD:278523 7/21 (33%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 9/23 (39%)
C2H2 Zn finger 311..329 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.