DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and CG31365

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:395 Identity:90/395 - (22%)
Similarity:135/395 - (34%) Gaps:122/395 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SLCDKIESLSGIQIRATAKEEVLPTRICLRCKA-----------FLTL--------AHKFRQICQ 83
            ||.|  .:|...:.|..||||    ...|.|..           .|.|        ...||:|..
  Fly   260 SLVD--ANLKATEARKDAKEE----EFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINM 318

  Fly    84 RSNEFLRE-----YVIKDAVEQGVVKEVVQQTRPSTPP------------------PIETEQLEP 125
            ..::.:..     |:|..|..:       .|.:.|||.                  ....|:.|.
  Fly   319 VGSDVVHTDNGEIYIINSASSE-------DQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEE 376

  Fly   126 PEDEVL---------EEGVWSTEDPI-----------EETPHGPAEKERPTVLTVEMLPAPYPPP 170
            .||.|:         |:.|:|..:.:           |:|   |.:::|.:.|.       :...
  Fly   377 IEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQT---PLKRKRSSELV-------FKQE 431

  Fly   171 ASTPPPAPAGAVKG--KLHVCAICGNGYPRKSTLDTHMRRH------NDERPYECEICHKSFHVN 227
            :|.|.| ..|.:..  |...|.:|...:|.:..|..|...|      ......:|..|.......
  Fly   432 SSCPQP-KTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCA 495

  Fly   228 YQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHY-K 291
            ..||||:..|||.||:.|..|:.:|:.|..|.:|..||...:.:.|..|...|...|.|:.|. :
  Fly   496 SSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGR 560

  Fly   292 THTG-EKPHICQLCNKSFARIHNLVAHLQT---------------------QQHIN-----DPRL 329
            .|.| .:.|.|.||::||..:..|..||.|                     |:|:.     ..:|
  Fly   561 VHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCGRQFNDRSAVQRHVTTMHKVKNKL 625

  Fly   330 TAYLS 334
            |.|:|
  Fly   626 TDYIS 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 16/77 (21%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
DUF45 <204..281 CDD:302795 23/82 (28%)
COG5048 210..>345 CDD:227381 43/153 (28%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 7/24 (29%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 286..310 CDD:290200 10/25 (40%)
C2H2 Zn finger 301..320 CDD:275368 8/18 (44%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 21/75 (28%)
C2H2 Zn finger 485..505 CDD:275368 6/19 (32%)
zf-H2C2_2 497..522 CDD:290200 12/24 (50%)
C2H2 Zn finger 513..533 CDD:275368 6/19 (32%)
zf-H2C2_2 526..550 CDD:290200 7/23 (30%)
C2H2 Zn finger 541..562 CDD:275368 6/20 (30%)
C2H2 Zn finger 571..591 CDD:275368 8/19 (42%)
C2H2 Zn finger 598..617 CDD:275368 2/18 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.