Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650879.1 | Gene: | CG4360 / 42413 | FlyBaseID: | FBgn0038787 | Length: | 556 | Species: | Drosophila melanogaster |
Alignment Length: | 263 | Identity: | 65/263 - (24%) |
---|---|---|---|
Similarity: | 98/263 - (37%) | Gaps: | 99/263 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 TPHGPAEKERPTVLTVEMLPAPYPPPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRH 209
Fly 210 NDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLV--------------- 259
Fly 260 ----------------------------------------------------------------- 259
Fly 260 ----KHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQT 320
Fly 321 QQH 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
C2H2 Zn finger | 189..209 | CDD:275368 | 7/19 (37%) | ||
DUF45 | <204..281 | CDD:302795 | 35/160 (22%) | ||
COG5048 | 210..>345 | CDD:227381 | 49/198 (25%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 7/103 (7%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 13/108 (12%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 301..320 | CDD:275368 | 6/18 (33%) | ||
CG4360 | NP_650879.1 | C2H2 Zn finger | 144..164 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 157..181 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 172..192 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 185..209 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 200..220 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 3/19 (16%) | ||
zf-C2H2_8 | 287..363 | CDD:292531 | 28/76 (37%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 340..360 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 478..498 | CDD:275368 | |||
zf-H2C2_2 | 491..515 | CDD:290200 | |||
C2H2 Zn finger | 506..526 | CDD:275368 | |||
zf-H2C2_2 | 519..543 | CDD:290200 | |||
C2H2 Zn finger | 534..554 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45471447 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |