DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and CG17803

DIOPT Version :10

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_650657.2 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:475 Identity:100/475 - (21%)
Similarity:156/475 - (32%) Gaps:191/475 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CRTCLQDGEAHMVSIFQTAD---DRLPGGVSLCDKIESLSGIQIRATAKEEVLPTRICLRCKAFL 72
            ||||.:     ::|..:.|.   ||:  .::|...|:.::|:.|:...||  ||..||..|:..:
  Fly    86 CRTCFR-----IISRHEDAQDLYDRV--NIALLHHIKVITGVWIQQGVKE--LPHHICSTCQETV 141

  Fly    73 TLAHKFRQICQRSNEFLREYV-----------IKDAVEQGVVKEVVQQTR-------------PS 113
            ..:.:||..||:.::.||:..           ::..:|..:.:|..||.:             |.
  Fly   142 NKSMEFRAKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSSELLPD 206

  Fly   114 T---------PPPIETEQLEPPEDEV-----------LEEG----------VWSTEDPIEETPHG 148
            :         |...|..|....|||:           ||:.          ...|::.|.:..||
  Fly   207 SEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVDHG 271

  Fly   149 ----------------------------------PAEKERPTVLTVEMLPAPYPPPASTPPPAPA 179
                                              |.||.|.....::..|..|            
  Fly   272 AKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNY------------ 324

  Fly   180 GAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQ-HTGAKPY 243
                    ||..||:.:.::|.|..|:.|||..:.:||..|.|.|:..|....|:|. |.|..|:
  Fly   325 --------VCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPF 381

  Fly   244 TCQYCQRNFADRTSLVKHERT-------------------------------------------H 265
            .|.:|..:||:.:|..:|||.                                           |
  Fly   382 PCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFH 446

  Fly   266 RNERPYACKTCGKKFTYASVLK---------------------------MHYKTHTGEKPHICQL 303
            ...||:.||.|..||...|.:|                           .|...|||..||.|::
  Fly   447 NGSRPFQCKICQMKFADPSAMKRHQALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEI 511

  Fly   304 CNKSFARIHNLVAHLQTQQH 323
            |:..:...:||..|..|..|
  Fly   512 CDVHYRHRYNLNKHKNTDLH 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:462262 25/83 (30%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
COG5048 210..>345 CDD:227381 43/185 (23%)
C2H2 Zn finger 217..237 CDD:275368 7/20 (35%)
C2H2 Zn finger 245..265 CDD:275368 8/62 (13%)
C2H2 Zn finger 273..293 CDD:275368 8/46 (17%)
C2H2 Zn finger 301..320 CDD:275368 5/18 (28%)
CG17803NP_650657.2 zf-AD 86..160 CDD:214871 24/82 (29%)
SUF4-like 320..>376 CDD:411020 20/75 (27%)
C2H2 Zn finger 323..351 CDD:411020 11/47 (23%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:411020 7/20 (35%)
C2H2 Zn finger 354..375 CDD:275368 7/20 (35%)
C2H2 Zn finger 383..401 CDD:275368 6/17 (35%)
C2H2 Zn finger 426..446 CDD:275368 0/19 (0%)
C2H2 Zn finger 454..474 CDD:275368 7/19 (37%)
C2H2 Zn finger 481..501 CDD:275368 1/19 (5%)
C2H2 Zn finger 509..528 CDD:275368 5/18 (28%)

Return to query results.
Submit another query.