DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and CG1024

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_001138014.2	Gene:	CG1024 / 40789	FlyBaseID:	FBgn0027514	Length:	543	Species:	Drosophila melanogaster

Alignment Length:	126	Identity:	29/126 - (23%)
Similarity:	51/126 - (40%)	Gaps:	23/126 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   199 KSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIR-QHTGAKPYTCQYCQRNFADRTSLVKHE 262
            :|.|:..:..|   ..|.|..|.|:|....:.::|:. :|        .|.::.::|...:...|
  Fly    15 QSRLNARLEAH---MVYICPECGKAFRTQAEWRQHLNTKH--------DYLKKTYSDFNFIQIDE 68

  Fly   263 RTHRNERPYACKTCGKKFTYA----SVLKMHYKTH-TGEKPHICQLCNKSFARIHNLVAHL 318
            |.|.      |:.|.|....|    ::|:.||..| ...:.:.|..|..::.|...|..||
  Fly    69 RFHE------CQLCFKWVENAHKTIALLQYHYFMHLEHSETYRCVHCRMAYTRRRALNVHL 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	2/9 (22%)
		DUF45	<204..281	CDD:302795	16/77 (21%)
		COG5048	210..>345	CDD:227381	26/115 (23%)
		C2H2 Zn finger	217..237	CDD:275368	5/20 (25%)
		C2H2 Zn finger	245..265	CDD:275368	4/19 (21%)
		zf-H2C2_2	257..282	CDD:290200	6/24 (25%)
		C2H2 Zn finger	273..293	CDD:275368	7/23 (30%)
		zf-H2C2_2	286..310	CDD:290200	6/24 (25%)
		C2H2 Zn finger	301..320	CDD:275368	6/18 (33%)
CG1024	NP_001138014.2	C2H2 Zn finger	30..51	CDD:275368	5/20 (25%)
		C2H2 Zn finger	73..100	CDD:275368	8/26 (31%)
		C2H2 Zn finger	106..123	CDD:275368	4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24409
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100