DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and Kr

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:258 Identity:87/258 - (33%)
Similarity:111/258 - (43%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 QQTRPSTPPPIETEQLEPPEDEVLEEGVWSTEDPIEETP--HGPAEKERPTVLTVEMLP------ 164
            |.|...:||......|..|    |..|......| ..||  |.||:|.|...:..|...      
  Fly   117 QGTHLHSPPASPHSPLSTP----LGSGKHPLNSP-NSTPQHHEPAKKARKLSVKKEFQTEISMSV 176

  Fly   165 --------APYPPPASTPPP--------APAGAV-------KGKLHVCAICGNGYPRKSTLDTHM 206
                    .|..||:|...|        ..||.|       :.|...|.||...:..|..|..|.
  Fly   177 NDMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNHE 241

  Fly   207 RRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPY 271
            |.|..|:|:||..|||.|..::.||.|:|.|||.|||.|.:|.|.|....:|.:|.|.|..||||
  Fly   242 RTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPY 306

  Fly   272 ACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHINDPRLTAYLS 334
            .|:.|..||:.::.||.|...|.||||..|:.|:..|.|.|:|:.|....|....|.|:..:|
  Fly   307 TCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNHKCGIQSPPTPALSPAMS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
DUF45 <204..281 CDD:302795 36/76 (47%)
COG5048 210..>345 CDD:227381 53/125 (42%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..320 CDD:275368 7/18 (39%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
zf-H2C2_2 237..261 CDD:290200 12/23 (52%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
zf-H2C2_2 264..289 CDD:290200 14/24 (58%)
C2H2 Zn finger 280..300 CDD:275368 7/19 (37%)
zf-H2C2_2 292..316 CDD:290200 11/23 (48%)
C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
zf-H2C2_2 321..345 CDD:290200 11/23 (48%)
C2H2 Zn finger 336..352 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.