DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and pita

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster


Alignment Length:483 Identity:97/483 - (20%)
Similarity:167/483 - (34%) Gaps:163/483 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEIRLNMMT---LCRTCLQDGEAHMVSIFQTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPT 62
            :|:|..|:|   :||.||.  |..:.|||: .:.|:....:|..:|.:::.|::.|   .:.:|.
  Fly     5 LEVREAMLTEKRVCRFCLT--EQKLASIFE-ENPRVKTTANLPLQIMAITAIEVYA---GDGMPG 63

  Fly    63 RICLRCKAFLTLAHKFRQICQRSNEFLREY----------------------------------- 92
            .|||.|:......::|:|:|:|:...||:|                                   
  Fly    64 HICLECRLLFEHCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEP 128

  Fly    93 ------------------VIKD-------------------------AVE--------------Q 100
                              :|:|                         |.|              |
  Fly   129 SETPKKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQ 193

  Fly   101 GVVKEVVQQTR------PSTPPPIETEQLEPPEDEVLEEGVWSTEDPIEETPHGPAEKERPTVLT 159
            .:::::..:..      |....|::.:.|......:|.:|..:..:|...||....:......:.
  Fly   194 SMLEDMASELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIV 258

  Fly   160 VEMLPAPYPPPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSF 224
            .|:|.:..|......|...|..|...:..|..|...:|.:..|:.|...|...|.::|.:|.|||
  Fly   259 TEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSF 323

  Fly   225 HVNYQLKRHIRQHTGAKPYTCQ----------------------------YCQRNFADRTSLVKH 261
            ...|.|.:|...|||.:|:.|.                            ||::.|..|..:.||
  Fly   324 FSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKH 388

  Fly   262 ERTHRNERPYACKTCGKKFTY----------------------------ASVLKMHYKTHTGEKP 298
            ...|:.:||:.|..|.|.|.:                            ||.|..|...|.|::.
  Fly   389 AERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRA 453

  Fly   299 HICQLCNKSFARIHNLVAHLQTQQHIND 326
            :.|:.|:||:...|:|..||:|....:|
  Fly   454 YPCKYCHKSYMLSHHLSRHLRTHTQTSD 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 24/81 (30%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
DUF45 <204..281 CDD:302795 28/104 (27%)
COG5048 210..>345 CDD:227381 43/173 (25%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 245..265 CDD:275368 7/47 (15%)
zf-H2C2_2 257..282 CDD:290200 9/24 (38%)
C2H2 Zn finger 273..293 CDD:275368 8/47 (17%)
zf-H2C2_2 286..310 CDD:290200 8/23 (35%)
C2H2 Zn finger 301..320 CDD:275368 8/18 (44%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 23/80 (29%)
COG5048 <281..506 CDD:227381 50/201 (25%)
C2H2 Zn finger 288..308 CDD:275368 5/19 (26%)
C2H2 Zn finger 316..336 CDD:275368 8/19 (42%)
zf-H2C2_2 328..353 CDD:290200 7/24 (29%)
C2H2 Zn finger 344..364 CDD:275368 1/19 (5%)
C2H2 Zn finger 372..388 CDD:275370 4/15 (27%)
C2H2 Zn finger 400..420 CDD:275368 4/19 (21%)
C2H2 Zn finger 428..448 CDD:275368 4/19 (21%)
C2H2 Zn finger 456..476 CDD:275368 8/19 (42%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.