Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611806.3 | Gene: | pita / 37730 | FlyBaseID: | FBgn0034878 | Length: | 683 | Species: | Drosophila melanogaster |
Alignment Length: | 483 | Identity: | 97/483 - (20%) |
---|---|---|---|
Similarity: | 167/483 - (34%) | Gaps: | 163/483 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEIRLNMMT---LCRTCLQDGEAHMVSIFQTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPT 62
Fly 63 RICLRCKAFLTLAHKFRQICQRSNEFLREY----------------------------------- 92
Fly 93 ------------------VIKD-------------------------AVE--------------Q 100
Fly 101 GVVKEVVQQTR------PSTPPPIETEQLEPPEDEVLEEGVWSTEDPIEETPHGPAEKERPTVLT 159
Fly 160 VEMLPAPYPPPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSF 224
Fly 225 HVNYQLKRHIRQHTGAKPYTCQ----------------------------YCQRNFADRTSLVKH 261
Fly 262 ERTHRNERPYACKTCGKKFTY----------------------------ASVLKMHYKTHTGEKP 298
Fly 299 HICQLCNKSFARIHNLVAHLQTQQHIND 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | 24/81 (30%) |
C2H2 Zn finger | 189..209 | CDD:275368 | 5/19 (26%) | ||
DUF45 | <204..281 | CDD:302795 | 28/104 (27%) | ||
COG5048 | 210..>345 | CDD:227381 | 43/173 (25%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 7/47 (15%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/47 (17%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 301..320 | CDD:275368 | 8/18 (44%) | ||
pita | NP_611806.3 | zf-AD | 17..92 | CDD:214871 | 23/80 (29%) |
COG5048 | <281..506 | CDD:227381 | 50/201 (25%) | ||
C2H2 Zn finger | 288..308 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 316..336 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 328..353 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 344..364 | CDD:275368 | 1/19 (5%) | ||
C2H2 Zn finger | 372..388 | CDD:275370 | 4/15 (27%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 428..448 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 456..476 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 486..506 | CDD:275368 | |||
HARE-HTH | <566..625 | CDD:294801 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 62 | 1.000 | Inparanoid score | I2531 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |