DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and CG10543

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster


Alignment Length:143 Identity:50/143 - (34%)
Similarity:76/143 - (53%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 VCAICGNGYPRKSTLDTH-MRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAK-PYTCQYCQR 250
            :|.:||..:..|:.|..| :|.|..:..:||.|||..|.:...|:||::.||..| ||.|..|..
  Fly   838 ICEVCGEEFQSKNALYQHIIRVHKRDNFFECHICHNRFTLKANLERHVQLHTEIKRPYVCDLCGS 902

  Fly   251 NFADRTSLVKH-ERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNL 314
            ::....:|.:| ...|.:.....|..|||:|..|..|:.|..:|:.|:||.|..|:::|....:|
  Fly   903 SYFTYPALKEHYSNAHVDVSECKCTLCGKRFGSAKSLQRHLPSHSEERPHCCNYCDQTFKWKTHL 967

  Fly   315 VAHLQTQQHINDP 327
            |.|.|| .|.|:|
  Fly   968 VRHKQT-MHGNEP 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 7/20 (35%)
DUF45 <204..281 CDD:302795 26/79 (33%)
COG5048 210..>345 CDD:227381 42/120 (35%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 245..265 CDD:275368 4/20 (20%)
zf-H2C2_2 257..282 CDD:290200 8/25 (32%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 9/23 (39%)
C2H2 Zn finger 301..320 CDD:275368 6/18 (33%)
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368
C2H2 Zn finger 751..773 CDD:275368
C2H2 Zn finger 781..801 CDD:275368
PHA00733 <804..860 CDD:177301 7/21 (33%)
C2H2 Zn finger 811..827 CDD:275368
C2H2 Zn finger 839..860 CDD:275368 7/20 (35%)
C2H2 Zn finger 868..888 CDD:275368 8/19 (42%)
C2H2 Zn finger 897..913 CDD:275368 3/15 (20%)
C2H2 Zn finger 926..946 CDD:275368 8/19 (42%)
C2H2 Zn finger 954..975 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.