DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and az2

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_610289.2	Gene:	az2 / 35682	FlyBaseID:	FBgn0025185	Length:	593	Species:	Drosophila melanogaster

Alignment Length:	141	Identity:	45/141 - (31%)
Similarity:	68/141 - (48%)	Gaps:	8/141 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   189 CAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTG---AKPYTCQYCQR 250
            |.:|...:.||..|..|.:|.:.::.:.||||.:||....||..|.|.|..   |||:.|::|.:
  Fly   408 CTLCELNFDRKCHLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGK 472

  Fly   251 NFADRTSLVKH-ERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNL 314
            .|..:..:..| ...|...|.:.|..|.|.|.....||.|.|.|...:..:|::|.|:|...:.|
  Fly   473 CFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANAL 537

  Fly   315 VAHLQTQQHIN 325
            |.|    :||:
  Fly   538 VKH----RHIH 544

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	6/19 (32%)
		DUF45	<204..281	CDD:302795	25/80 (31%)
		COG5048	210..>345	CDD:227381	38/120 (32%)
		C2H2 Zn finger	217..237	CDD:275368	10/19 (53%)
		C2H2 Zn finger	245..265	CDD:275368	4/20 (20%)
		zf-H2C2_2	257..282	CDD:290200	7/25 (28%)
		C2H2 Zn finger	273..293	CDD:275368	8/19 (42%)
		zf-H2C2_2	286..310	CDD:290200	9/23 (39%)
		C2H2 Zn finger	301..320	CDD:275368	7/18 (39%)
az2	NP_610289.2	MADF_DNA_bdg	157..242	CDD:287510
		GT1	276..>341	CDD:304916
		C2H2 Zn finger	377..398	CDD:275368
		C2H2 Zn finger	408..429	CDD:275368	7/20 (35%)
		C2H2 Zn finger	436..456	CDD:275368	10/19 (53%)
		C2H2 Zn finger	467..488	CDD:275368	4/20 (20%)
		C2H2 Zn finger	496..516	CDD:275368	8/19 (42%)
		C2H2 Zn finger	524..544	CDD:275368	8/23 (35%)
		C2H2 Zn finger	551..572	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24409
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100