DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and CG12299

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_609448.1	Gene:	CG12299 / 34483	FlyBaseID:	FBgn0032295	Length:	736	Species:	Drosophila melanogaster

Alignment Length:	135	Identity:	56/135 - (41%)
Similarity:	79/135 - (58%)	Gaps:	0/135 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   188 VCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNF 252
            :|..|...:..::.||.|||.|..|..|:|.||.::|..:.:|.:|::.|.|.||:||..|.|:|
  Fly   368 ICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSF 432

  Fly   253 ADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAH 317
            ....||..|.|.|..|:|:.||.|.|.||.||.|.:|.|.|.||||:.|.:|.||:::...|..|
  Fly   433 TQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKH 497

  Fly   318 LQTQQ 322
            :|..|
  Fly   498 IQAHQ 502

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	7/19 (37%)
		DUF45	<204..281	CDD:302795	32/76 (42%)
		COG5048	210..>345	CDD:227381	48/113 (42%)
		C2H2 Zn finger	217..237	CDD:275368	6/19 (32%)
		C2H2 Zn finger	245..265	CDD:275368	8/19 (42%)
		zf-H2C2_2	257..282	CDD:290200	12/24 (50%)
		C2H2 Zn finger	273..293	CDD:275368	11/19 (58%)
		zf-H2C2_2	286..310	CDD:290200	12/23 (52%)
		C2H2 Zn finger	301..320	CDD:275368	6/18 (33%)
CG12299	NP_609448.1	COG5048	<254..413	CDD:227381	15/44 (34%)
		C2H2 Zn finger	256..276	CDD:275368
		zf-H2C2_2	268..293	CDD:290200
		C2H2 Zn finger	284..304	CDD:275368
		zf-H2C2_2	296..321	CDD:290200
		zf-C2H2_2	312..>387	CDD:289522	5/18 (28%)
		C2H2 Zn finger	312..332	CDD:275368
		C2H2 Zn finger	340..360	CDD:275368
		C2H2 Zn finger	369..389	CDD:275368	7/19 (37%)
		C2H2 Zn finger	397..417	CDD:275368	6/19 (32%)
		zf-H2C2_2	409..434	CDD:290200	11/24 (46%)
		C2H2 Zn finger	425..445	CDD:275368	8/19 (42%)
		zf-H2C2_2	437..462	CDD:290200	12/24 (50%)
		C2H2 Zn finger	453..473	CDD:275368	11/19 (58%)
		zf-H2C2_2	465..490	CDD:290200	12/24 (50%)
		C2H2 Zn finger	481..501	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24409
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100