DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and zf30C

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_477301.1	Gene:	zf30C / 34292	FlyBaseID:	FBgn0270924	Length:	777	Species:	Drosophila melanogaster

Alignment Length:	117	Identity:	44/117 - (37%)
Similarity:	62/117 - (52%)	Gaps:	4/117 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   186 LHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIR-QHTGAKPYTCQYCQ 249
            |:.|::||........|.|||..|..:.||:|:.|.|:|.|..|.|.|:: :||..|||.|..|.
  Fly   572 LYGCSVCGKHLSTAGILKTHMLLHKADTPYQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCP 636

  Fly   250 RNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHT---GEKP 298
            :.:..|.||:.|...|...:.:.|..|||:||..|.|:.|.|.|.   |:.|
  Fly   637 KEYPYRESLLTHMTVHTGIKRFLCNNCGKRFTCISNLQAHRKVHADTCGQLP 688

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	7/19 (37%)
		DUF45	<204..281	CDD:302795	30/77 (39%)
		COG5048	210..>345	CDD:227381	35/93 (38%)
		C2H2 Zn finger	217..237	CDD:275368	8/20 (40%)
		C2H2 Zn finger	245..265	CDD:275368	6/19 (32%)
		zf-H2C2_2	257..282	CDD:290200	9/24 (38%)
		C2H2 Zn finger	273..293	CDD:275368	10/19 (53%)
		zf-H2C2_2	286..310	CDD:290200	6/16 (38%)
		C2H2 Zn finger	301..320	CDD:275368
zf30C	NP_477301.1	C2H2 Zn finger	33..53	CDD:275368
		C2H2 Zn finger	61..82	CDD:275368
		C2H2 Zn finger	98..117	CDD:275368
		C2H2 Zn finger	134..152	CDD:275368
		C2H2 Zn finger	511..532	CDD:275370
		COG5048	<523..>672	CDD:227381	37/99 (37%)
		C2H2 Zn finger	546..566	CDD:275368
		C2H2 Zn finger	575..595	CDD:275368	7/19 (37%)
		C2H2 Zn finger	603..624	CDD:275368	8/20 (40%)
		C2H2 Zn finger	632..652	CDD:275368	6/19 (32%)
		C2H2 Zn finger	660..680	CDD:275368	10/19 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24409
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100