| Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005162831.1 | Gene: | mynn / 327167 | ZFINID: | ZDB-GENE-030131-5378 | Length: | 823 | Species: | Danio rerio |
| Alignment Length: | 245 | Identity: | 76/245 - (31%) |
|---|---|---|---|
| Similarity: | 106/245 - (43%) | Gaps: | 71/245 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 119 ETEQLEPPEDEVLEEGV-WSTEDPIEETPHGPAEKERPTVLTVEMLPAPYPPPASTPPPAPAGAV 182
Fly 183 KGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQY 247
Fly 248 CQRNFADRTSLVK-----------------------------HERTHRNERPYACKTCGKKFTYA 283
Fly 284 SVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHINDPRLTAYL 333 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
| C2H2 Zn finger | 189..209 | CDD:275368 | 10/19 (53%) | ||
| DUF45 | <204..281 | CDD:302795 | 37/105 (35%) | ||
| COG5048 | 210..>345 | CDD:227381 | 56/153 (37%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 8/48 (17%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 13/53 (25%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 301..320 | CDD:275368 | 7/18 (39%) | ||
| mynn | XP_005162831.1 | BTB | 14..114 | CDD:279045 | |
| BTB | 25..113 | CDD:197585 | |||
| C2H2 Zn finger | 472..492 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 484..509 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 500..520 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 513..537 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 528..548 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 541..566 | CDD:290200 | 2/24 (8%) | ||
| zf-C2H2 | 555..577 | CDD:278523 | 2/21 (10%) | ||
| C2H2 Zn finger | 557..577 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 569..594 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 585..605 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 598..621 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 613..633 | CDD:275368 | 7/21 (33%) | ||
| C2H2 Zn finger | 641..661 | CDD:275368 | 76/245 (31%) | ||
| C2H2 Zn finger | 669..685 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 164 | 1.000 | Inparanoid score | I4177 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||