DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and CG43347

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster


Alignment Length:209 Identity:54/209 - (25%)
Similarity:81/209 - (38%) Gaps:58/209 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 KLHVCAICGNGYPRKSTLDTH-MRRHNDERPYECEICHKSF-HVNY------------------- 228
            |.| |.:||.....|..:..| ..:|:.:..|:|:.|.|.| .:||                   
  Fly  1195 KYH-CKVCGEPVLGKDNIMKHAAEKHDGKGAYQCQFCSKFFLRLNYLEMHRTYGCASNPNRSRPV 1258

  Fly   229 ------------QLKRHI-RQHTG----AKPYTCQYCQRNFADRTSLVKHER-TH-RNERPYACK 274
                        :||.|| |.|:.    .:.:.|:.|.:....|.:|.:|.: .| ||....:|.
  Fly  1259 CDFCGRKFCQPQKLKAHIKRMHSDMAEVLRDFQCKLCSKLLGSRAALQRHSKEVHSRNSTVVSCP 1323

  Fly   275 TCGKKFTYASVLKMHYKTHTGEKPHIC--QLCNKSFA-----RIHNLVAHLQTQQHINDPRL--- 329
            .|.|.|...|.||:|..||:|.:|..|  ..||.:|.     :.|....|..||:.:  |::   
  Fly  1324 RCQKLFQNRSNLKIHMLTHSGVRPFKCAEPECNAAFTTKQCLQFHYKKVHNYTQEQM--PKIERS 1386

  Fly   330 -----TAYLSTFKV 338
                 .||....||
  Fly  1387 VAYTFDAYSGGMKV 1400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 5/20 (25%)
DUF45 <204..281 CDD:302795 26/116 (22%)
COG5048 210..>345 CDD:227381 46/183 (25%)
C2H2 Zn finger 217..237 CDD:275368 11/52 (21%)
C2H2 Zn finger 245..265 CDD:275368 5/20 (25%)
zf-H2C2_2 257..282 CDD:290200 9/26 (35%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 11/30 (37%)
C2H2 Zn finger 301..320 CDD:275368 6/25 (24%)
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 13/69 (19%)
C2H2 Zn finger 1198..1219 CDD:275368 5/20 (25%)
C2H2 Zn finger 1227..1255 CDD:275368 6/27 (22%)
C2H2 Zn finger 1259..1280 CDD:275368 5/20 (25%)
C2H2 Zn finger 1292..1313 CDD:275368 5/20 (25%)
C2H2 Zn finger 1322..1342 CDD:275368 8/19 (42%)
zf-H2C2_2 1334..1361 CDD:290200 11/26 (42%)
C2H2 Zn finger 1350..1373 CDD:275368 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.