DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and CG2120

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:287 Identity:75/287 - (26%)
Similarity:96/287 - (33%) Gaps:98/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PIETEQLEPPEDEVLEEGVWSTEDPIEETPHGPAE----KERPTV-------------------- 157
            |:|.|.|.|..:..|.|.|.........|.|.|.:    |..||.                    
  Fly    45 PMEMELLNPGSEYDLLELVNGALQQRNTTEHKPTDMCKPKRTPTTKRHRTTGKDHTCDICDRRFS 109

  Fly   158 ----LTVEMLPAPYPPPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECE 218
                |.:..:......|                |||..||.|:.:.:.|..|...|..|||::|:
  Fly   110 EAYNLRIHKMTHTDEKP----------------HVCVECGKGFRQLNKLRIHAVTHTAERPHKCD 158

  Fly   219 ICHKSF-HVNYQLKRHIRQHTGAKPY--------------------------------------- 243
            ||.|.| :.|| |..|.|.|||.|||                                       
  Fly   159 ICGKGFRYANY-LTVHRRLHTGEKPYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHPLAE 222

  Fly   244 -----------TCQYCQRNFADRTSLVKHERTHRNERPYAC--KTCGKKFTYASVLKMHYKTHTG 295
                       ||..|.|...|:..|..|.:.|.|:|.:.|  ..|||:|..||.||.|...||.
  Fly   223 QEQRDTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQ 287

  Fly   296 EKPHICQLCNKSFARIHNLVAHLQTQQ 322
            ::|..|.||...|.|..|...||:..:
  Fly   288 QRPFACPLCPARFLRKSNHKQHLKVHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
DUF45 <204..281 CDD:302795 35/129 (27%)
COG5048 210..>345 CDD:227381 50/166 (30%)
C2H2 Zn finger 217..237 CDD:275368 10/20 (50%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 10/26 (38%)
C2H2 Zn finger 273..293 CDD:275368 10/21 (48%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..320 CDD:275368 8/18 (44%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 1/19 (5%)
zf-H2C2_2 113..138 CDD:290200 8/40 (20%)
C2H2 Zn finger 129..149 CDD:275368 6/19 (32%)
zf-H2C2_2 142..166 CDD:290200 11/23 (48%)
COG5048 151..>264 CDD:227381 29/113 (26%)
C2H2 Zn finger 157..177 CDD:275368 10/20 (50%)
C2H2 Zn finger 185..206 CDD:275368 0/20 (0%)
C2H2 Zn finger 235..255 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..285 CDD:275368 10/21 (48%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.