DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and ace2

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:231 Identity:59/231 - (25%)
Similarity:89/231 - (38%) Gaps:53/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KAFLTLA---------HKFRQICQRSNEFLREYVIKDAVEQGVVKEVVQQTRPSTP--PPIETEQ 122
            |||..|:         .||..:|...         .|.....:...:.||...|.|  ..|.|::
pombe   313 KAFAKLSSPAEYVSEFEKFSSVCDHG---------LDISNANINNTLTQQFALSAPYESCIVTKK 368

  Fly   123 LEP----PEDEVLEEGVWSTEDPIEETPHGPAEKERPTVLTVEMLPAPYPPPAST---------- 173
            .||    .|:|.|...:.|.:  :..||.......:|.|      ...|.....|          
pombe   369 PEPCITVKEEEQLAPKIESAD--LSITPQVTEHDSKPPV------RISYDHRCKTRKQSTRICRI 425

  Fly   174 PPPAPAG-----AVKGKLHVCAI--CGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLK 231
            ||...|.     ...|| :||..  |.....||..:::|::.|..:|||.|::|...|..::.||
pombe   426 PPETMASLYCGPEADGK-YVCLYNGCNKRIARKYNVESHIQTHLSDRPYRCDLCKAGFVRHHDLK 489

  Fly   232 RHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRN 267
            ||:|.|...:||.|: |.:.|....:|.:|::  ||
pombe   490 RHLRIHENGRPYVCE-CLKRFNRLDALNRHKQ--RN 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 7/31 (23%)
C2H2 Zn finger 189..209 CDD:275368 5/21 (24%)
DUF45 <204..281 CDD:302795 23/64 (36%)
COG5048 210..>345 CDD:227381 21/58 (36%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
zf-H2C2_2 257..282 CDD:290200 4/11 (36%)
C2H2 Zn finger 273..293 CDD:275368
zf-H2C2_2 286..310 CDD:290200
C2H2 Zn finger 301..320 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 56/223 (25%)
C2H2 Zn finger 448..467 CDD:275368 4/18 (22%)
zf-C2H2 473..495 CDD:278523 9/21 (43%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
zf-H2C2_2 487..511 CDD:290200 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.