DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and Opbp

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:349 Identity:81/349 - (23%)
Similarity:129/349 - (36%) Gaps:84/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SIFQTADDRLPGGVSLCDKIES-----------------LSGIQIRATAKEEVLPTRICLRCKAF 71
            |||   ::|......:|.:.||                 |:.:..| |...:......|..|...
  Fly   124 SIF---ENRNKAEEHICPRAESGGSSQQDGDAKAPVRRKLASVSAR-TGPRDASSVISCGICNTV 184

  Fly    72 LTLAHKFRQICQRSNEFLREYVIKDAVEQGVVK----------EVVQQTRPSTPPPIETEQLEPP 126
            .: :.||.:...|.:|......|:||:..|..:          |:..::...|...:..:..:..
  Fly   185 FS-SEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSFDETLLTVHKQMHQQE 248

  Fly   127 EDEVL---------EEGVWSTEDPIEETPHG-----------PAEKERPTVLTVEMLPAPYPPPA 171
            ..|::         .|..:.....|.|.|..           ..:||:|          .:|   
  Fly   249 SSEIMCSICNRKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKP----------GFP--- 300

  Fly   172 STPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQ 236
                             |..|...:.|......|.|.|..|:||.||:|.|:|.|:|.|..|:|.
  Fly   301 -----------------CQYCERVFTRPFEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLRT 348

  Fly   237 HTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHIC 301
            ||..:||.|..|.:.|........|.|.|.:||.::|..|.|.|..:..|..|..|||  ||:.|
  Fly   349 HTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTHT--KPYRC 411

  Fly   302 QLCNKSFARIHNLVAHLQTQQHIN 325
            .:||:.|:.::.:..|:||.:.|:
  Fly   412 AVCNRPFSSMYAVKNHMQTHKEIS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 16/84 (19%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
DUF45 <204..281 CDD:302795 31/76 (41%)
COG5048 210..>345 CDD:227381 44/116 (38%)
C2H2 Zn finger 217..237 CDD:275368 10/19 (53%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
zf-H2C2_2 257..282 CDD:290200 9/24 (38%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..320 CDD:275368 5/18 (28%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 1/19 (5%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 316..336 CDD:290200 10/19 (53%)
C2H2 Zn finger 329..349 CDD:275368 10/19 (53%)
zf-H2C2_2 341..366 CDD:290200 10/24 (42%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 411..431 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.