DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and Zfp771

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_796336.1 Gene:Zfp771 / 244216 MGIID:2442050 Length:317 Species:Mus musculus


Alignment Length:255 Identity:84/255 - (32%)
Similarity:108/255 - (42%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PIETEQLEPPEDEVLEEGVWSTEDPIEETPHGPAEKERPTVLTV--------EMLPAPYPPPA-- 171
            |.|.:..|..|:|:.||.|...:...||    ..||.....|.:        ..:|||...||  
Mouse     2 PGEQQAEEEEEEEMQEEMVLLVKGEEEE----GEEKYEVVKLKIPVDNKEVASQMPAPSADPARP 62

  Fly   172 -STPPPAPAGAVKGKL------------HVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKS 223
             :.|....|.|.:..|            ..|..||..:.:||.|..|.|.|..||||:|..|.|.
Mouse    63 HACPDCGRAFARRSTLAKHARTHTGERPFACTECGRCFSQKSALTKHGRTHTGERPYQCPECDKR 127

  Fly   224 FHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTS----------------------------LVK 260
            |.....|::|.|:|||.|||.|.:|.|.||..::                            |.:
Mouse   128 FSAASNLRQHRRRHTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDCGRAFGGSSCLAR 192

  Fly   261 HERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQT 320
            |.|||..||||||..||.:|..:|.|..|.:.|||||||.|.:|.:.|....||..|.:|
Mouse   193 HRRTHTGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRFGHRSNLAEHART 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 8/19 (42%)
DUF45 <204..281 CDD:302795 38/104 (37%)
COG5048 210..>345 CDD:227381 53/139 (38%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
C2H2 Zn finger 245..265 CDD:275368 8/47 (17%)
zf-H2C2_2 257..282 CDD:290200 14/52 (27%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..320 CDD:275368 6/18 (33%)
Zfp771NP_796336.1 C2H2 Zn finger 65..85 CDD:275368 4/19 (21%)
COG5048 <90..245 CDD:227381 58/154 (38%)
C2H2 Zn finger 93..113 CDD:275368 8/19 (42%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 177..197 CDD:275368 3/19 (16%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
C2H2 Zn finger 233..253 CDD:275368 7/20 (35%)
zf-H2C2_2 245..269 CDD:404364 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.