Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_796336.1 | Gene: | Zfp771 / 244216 | MGIID: | 2442050 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 255 | Identity: | 84/255 - (32%) |
---|---|---|---|
Similarity: | 108/255 - (42%) | Gaps: | 55/255 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 PIETEQLEPPEDEVLEEGVWSTEDPIEETPHGPAEKERPTVLTV--------EMLPAPYPPPA-- 171
Fly 172 -STPPPAPAGAVKGKL------------HVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKS 223
Fly 224 FHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTS----------------------------LVK 260
Fly 261 HERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQT 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
C2H2 Zn finger | 189..209 | CDD:275368 | 8/19 (42%) | ||
DUF45 | <204..281 | CDD:302795 | 38/104 (37%) | ||
COG5048 | 210..>345 | CDD:227381 | 53/139 (38%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 8/47 (17%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 14/52 (27%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 301..320 | CDD:275368 | 6/18 (33%) | ||
Zfp771 | NP_796336.1 | C2H2 Zn finger | 65..85 | CDD:275368 | 4/19 (21%) |
COG5048 | <90..245 | CDD:227381 | 58/154 (38%) | ||
C2H2 Zn finger | 93..113 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 121..141 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 149..169 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 245..269 | CDD:404364 | 4/8 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 140 | 1.000 | Inparanoid score | I4481 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |