DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and Zbtb16

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001028496.1 Gene:Zbtb16 / 235320 MGIID:103222 Length:673 Species:Mus musculus


Alignment Length:132 Identity:55/132 - (41%)
Similarity:78/132 - (59%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 CAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNFA 253
            |.:||..:..:|.|..||..|...|.|.|..|:::|..:..||||:|.|||..||.|::|...|.
Mouse   492 CLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFR 556

  Fly   254 DRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHL 318
            |.::|..|:|.|..|:||.|..|||||:....|:.||:.||||||..|:||::.......::.||
Mouse   557 DESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHL 621

  Fly   319 QT 320
            :|
Mouse   622 RT 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
DUF45 <204..281 CDD:302795 34/76 (45%)
COG5048 210..>345 CDD:227381 47/111 (42%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 9/19 (47%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..320 CDD:275368 5/18 (28%)
Zbtb16NP_001028496.1 BTB_POZ_ZBTB16_PLZF 16..122 CDD:349514
C2H2 Zn finger 406..426 CDD:275368
C2H2 Zn finger 434..454 CDD:275368
COG5048 <448..622 CDD:227381 53/129 (41%)
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
C2H2 Zn finger 520..540 CDD:275368 8/19 (42%)
C2H2 Zn finger 548..568 CDD:275368 7/19 (37%)
C2H2 Zn finger 576..596 CDD:275368 9/19 (47%)
C2H2 Zn finger 604..624 CDD:275368 6/20 (30%)
C2H2 Zn finger 632..652 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11721
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.