DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and ZSCAN4

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_001371762.1	Gene:	ZSCAN4 / 201516	HGNCID:	23709	Length:	433	Species:	Homo sapiens

Alignment Length:	129	Identity:	42/129 - (32%)
Similarity:	67/129 - (51%)	Gaps:	1/129 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   200 STLDTHMR-RHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHER 263
            ||.:.|.: .|..::.|:||.|.|.|.....|..|.|:|...:|:.|..||:.|...:.|..|:.
Human   296 STCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFFQISDLRVHQI 360

  Fly   264 THRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHINDP 327
            .|..::|:.|..|.|.|::.:.|:.|.:.||||||:.|..|..|:.:......|::|.:.|..|
Human   361 IHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEKITLP 424

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	3/9 (33%)
		DUF45	<204..281	CDD:302795	24/77 (31%)
		COG5048	210..>345	CDD:227381	38/118 (32%)
		C2H2 Zn finger	217..237	CDD:275368	8/19 (42%)
		C2H2 Zn finger	245..265	CDD:275368	6/19 (32%)
		zf-H2C2_2	257..282	CDD:290200	8/24 (33%)
		C2H2 Zn finger	273..293	CDD:275368	6/19 (32%)
		zf-H2C2_2	286..310	CDD:290200	11/23 (48%)
		C2H2 Zn finger	301..320	CDD:275368	4/18 (22%)
ZSCAN4	NP_001371762.1	SCAN	40..124	CDD:153421
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	165..210
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	275..301		2/4 (50%)
		zf-C2H2	312..334	CDD:395048	9/21 (43%)
		C2H2 Zn finger	314..334	CDD:275368	8/19 (42%)
		C2H2 Zn finger	342..362	CDD:275368	6/19 (32%)
		zf-C2H2	368..390	CDD:395048	6/21 (29%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
		zf-H2C2_2	382..407	CDD:404364	11/24 (46%)
		C2H2 Zn finger	398..418	CDD:275368	4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.000