| Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001022205.1 | Gene: | klf-3 / 191713 | WormBaseID: | WBGene00003480 | Length: | 315 | Species: | Caenorhabditis elegans |
| Alignment Length: | 259 | Identity: | 66/259 - (25%) |
|---|---|---|---|
| Similarity: | 99/259 - (38%) | Gaps: | 69/259 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 103 VKEVVQQTRPSTPPPIET--EQLEPPEDEVLEEGVWSTEDPIEETPHGPAEKERPTVLTVEMLPA 165
Fly 166 PYPP--PASTPPPAPAG----------AVKGKLHVCAICGNG-------------------YPRK 199
Fly 200 STLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQY--CQRNFADRTSLVKHE 262
Fly 263 RTHRNERPYACK--TCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHI 324 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
| C2H2 Zn finger | 189..209 | CDD:275368 | 6/38 (16%) | ||
| DUF45 | <204..281 | CDD:302795 | 20/80 (25%) | ||
| COG5048 | 210..>345 | CDD:227381 | 36/119 (30%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 13/26 (50%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 301..320 | CDD:275368 | 8/18 (44%) | ||
| klf-3 | NP_001022205.1 | C2H2 Zn finger | 235..254 | CDD:275368 | 5/18 (28%) |
| C2H2 Zn finger | 262..284 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 276..301 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 292..312 | CDD:275368 | 8/19 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||