DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and ztf-15

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_492052.2	Gene:	ztf-15 / 172470	WormBaseID:	WBGene00011066	Length:	729	Species:	Caenorhabditis elegans

Alignment Length:	141	Identity:	41/141 - (29%)
Similarity:	61/141 - (43%)	Gaps:	25/141 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   189 CAICGNGYPRKSTLDTHMRR-HNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNF 252
            |:|||......::|..|.:: |.......|.:|.|.|:....::||:......  :.||.|.||.
Worm   467 CSICGKFCVGVASLLHHRKQIHGLTAMLTCGVCTKKFNTLSSIRRHMSMEYSI--FRCQQCGRNC 529

  Fly   253 ADRTSLVKHERTHRNERPYACKTCGKK---FTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNL 314
            .|||:|.:||..    :||  |...|:   ....||||             |..|..:||.::.|
Worm   530 IDRTTLDRHECF----KPY--KIRDKRLFNIQNISVLK-------------CPDCRATFANLNVL 575

  Fly   315 VAHLQTQQHIN 325
            ..|.:|.|:.|
Worm   576 SEHRKTCQYGN 586

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	6/20 (30%)
		DUF45	<204..281	CDD:302795	23/80 (29%)
		COG5048	210..>345	CDD:227381	34/119 (29%)
		C2H2 Zn finger	217..237	CDD:275368	6/19 (32%)
		C2H2 Zn finger	245..265	CDD:275368	11/19 (58%)
		zf-H2C2_2	257..282	CDD:290200	7/27 (26%)
		C2H2 Zn finger	273..293	CDD:275368	6/22 (27%)
		zf-H2C2_2	286..310	CDD:290200	5/23 (22%)
		C2H2 Zn finger	301..320	CDD:275368	6/18 (33%)
ztf-15	NP_492052.2	C2H2 Zn finger	178..199	CDD:275368
		C2H2 Zn finger	207..223	CDD:275368
		C2H2 Zn finger	233..250	CDD:275368
		SFP1	<337..395	CDD:227516
		C2H2 Zn finger	467..488	CDD:275368	6/20 (30%)
		C2H2 Zn finger	496..514	CDD:275368	6/17 (35%)
		C2H2 Zn finger	522..538	CDD:275368	9/15 (60%)
		C2H2 Zn finger	562..581	CDD:275368	6/18 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24409
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100