| Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017211284.1 | Gene: | LOC108184006 / 108184006 | -ID: | - | Length: | 359 | Species: | Danio rerio |
| Alignment Length: | 265 | Identity: | 86/265 - (32%) |
|---|---|---|---|
| Similarity: | 113/265 - (42%) | Gaps: | 54/265 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 118 IETEQLEPPED-EVLEEGVWSTED--PIEETPH--GPAEKERPTVLTVEMLPAPYPPPASTPPPA 177
Fly 178 PAG--------------------AVKGKLHV------------CAICGNGYPRKSTLDTHMRRHN 210
Fly 211 DERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKT 275
Fly 276 CGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHINDPRLT--------AY 332
Fly 333 LSTFK 337 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
| C2H2 Zn finger | 189..209 | CDD:275368 | 7/19 (37%) | ||
| DUF45 | <204..281 | CDD:302795 | 39/76 (51%) | ||
| COG5048 | 210..>345 | CDD:227381 | 58/136 (43%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 301..320 | CDD:275368 | 8/18 (44%) | ||
| LOC108184006 | XP_017211284.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||