Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021325086.1 | Gene: | znf1178 / 103909503 | ZFINID: | ZDB-GENE-050208-466 | Length: | 322 | Species: | Danio rerio |
Alignment Length: | 263 | Identity: | 84/263 - (31%) |
---|---|---|---|
Similarity: | 103/263 - (39%) | Gaps: | 57/263 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 STPPPIETEQLEPPE---DEVLEEGVWSTEDPIEETPHGPAEKERPTVLTVEMLPAPYPPPASTP 174
Fly 175 PPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSF--------------- 224
Fly 225 --------------HVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKT 275
Fly 276 CGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHINDPRLTA-----YLST 335
Fly 336 FKV 338 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
C2H2 Zn finger | 189..209 | CDD:275368 | 10/19 (53%) | ||
DUF45 | <204..281 | CDD:302795 | 34/105 (32%) | ||
COG5048 | 210..>345 | CDD:227381 | 54/163 (33%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 10/48 (21%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 301..320 | CDD:275368 | 8/18 (44%) | ||
znf1178 | XP_021325086.1 | C2H2 Zn finger | 64..84 | CDD:275368 | 10/19 (53%) |
COG5048 | <88..276 | CDD:227381 | 53/160 (33%) | ||
C2H2 Zn finger | 92..112 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 120..140 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 148..168 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 176..196 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 204..224 | CDD:275368 | 9/21 (43%) | ||
C2H2 Zn finger | 232..252 | CDD:275368 | 4/13 (31%) | ||
C2H2 Zn finger | 260..280 | CDD:275368 | |||
C2H2 Zn finger | 288..308 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |