DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4424 and gzf1

DIOPT Version :9

Sequence 1:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_009299716.1 Gene:gzf1 / 103908658 ZFINID:ZDB-GENE-130731-1 Length:763 Species:Danio rerio


Alignment Length:141 Identity:59/141 - (41%)
Similarity:79/141 - (56%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 KLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQ 249
            |...|.:|...:.:...|..|.|.|..|:|:.||.|.|||.....||.|.|.|:|::||.|:.|.
Zfish   417 KPFACDLCDARFTQNHMLAYHRRCHTGEKPFMCENCGKSFASKEYLKHHNRIHSGSRPYKCETCG 481

  Fly   250 RNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSF-----A 309
            |.||.|.||.:|.:.|..||||.||.|.|:||..:.|:.|.:.||||||::|.:|.::|     .
Zfish   482 RAFAQRNSLHQHVKIHTGERPYHCKDCDKQFTQLNALQRHQRIHTGEKPYMCSMCGRTFTDKSTV 546

  Fly   310 RIHNLVAHLQT 320
            |.|.|....||
Zfish   547 RRHTLTHDKQT 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
DUF45 <204..281 CDD:302795 37/76 (49%)
COG5048 210..>345 CDD:227381 52/116 (45%)
C2H2 Zn finger 217..237 CDD:275368 10/19 (53%)
C2H2 Zn finger 245..265 CDD:275368 9/19 (47%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 11/28 (39%)
C2H2 Zn finger 301..320 CDD:275368 6/23 (26%)
gzf1XP_009299716.1 BTB 23..125 CDD:279045
BTB 32..122 CDD:197585
C2H2 Zn finger 275..295 CDD:275368
C2H2 Zn finger 306..327 CDD:275368
COG5048 <322..549 CDD:227381 55/131 (42%)
C2H2 Zn finger 335..354 CDD:275368
C2H2 Zn finger 365..385 CDD:275368
zf-H2C2_2 377..402 CDD:290200
C2H2 Zn finger 393..413 CDD:275368
zf-H2C2_2 405..430 CDD:290200 3/12 (25%)
C2H2 Zn finger 421..441 CDD:275368 5/19 (26%)
zf-H2C2_2 433..458 CDD:290200 12/24 (50%)
C2H2 Zn finger 449..469 CDD:275368 10/19 (53%)
zf-H2C2_2 461..486 CDD:290200 12/24 (50%)
C2H2 Zn finger 477..497 CDD:275368 9/19 (47%)
zf-H2C2_2 492..514 CDD:290200 11/21 (52%)
C2H2 Zn finger 505..525 CDD:275368 8/19 (42%)
zf-H2C2_2 517..541 CDD:290200 10/23 (43%)
C2H2 Zn finger 533..553 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.