DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and zgc:174703

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_001191325.1	Gene:	zgc:174703 / 100533191	ZFINID:	ZDB-GENE-080208-4	Length:	382	Species:	Danio rerio

Alignment Length:	135	Identity:	63/135 - (46%)
Similarity:	81/135 - (60%)	Gaps:	0/135 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   185 KLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQ 249
            |.:.|..||..:.:|.:|.||||.|..||||.|:.|.|||.....||.|:|.|||.:|||||.|.
Zfish   102 KPYTCEQCGKSFGKKRSLKTHMRIHTGERPYTCQQCGKSFKQIGTLKGHMRIHTGERPYTCQQCG 166

  Fly   250 RNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNL 314
            ::|....:|..|.|:|..||||.|:.||:.|.||.....|.:.||||||:.||.|.|||.:...|
Zfish   167 KSFKQSATLKGHMRSHTGERPYTCQQCGQSFYYAGNFAAHKRIHTGEKPYTCQQCGKSFKQSGTL 231

  Fly   315 VAHLQ 319
            ..|::
Zfish   232 KGHMR 236

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	9/19 (47%)
		DUF45	<204..281	CDD:302795	39/76 (51%)
		COG5048	210..>345	CDD:227381	52/110 (47%)
		C2H2 Zn finger	217..237	CDD:275368	9/19 (47%)
		C2H2 Zn finger	245..265	CDD:275368	7/19 (37%)
		zf-H2C2_2	257..282	CDD:290200	12/24 (50%)
		C2H2 Zn finger	273..293	CDD:275368	7/19 (37%)
		zf-H2C2_2	286..310	CDD:290200	13/23 (57%)
		C2H2 Zn finger	301..320	CDD:275368	8/19 (42%)
zgc:174703	NP_001191325.1	zf-H2C2_2	90..113	CDD:290200	4/10 (40%)
		C2H2 Zn finger	106..126	CDD:275368	9/19 (47%)
		COG5048	<115..361	CDD:227381	59/122 (48%)
		zf-H2C2_2	118..143	CDD:290200	15/24 (63%)
		C2H2 Zn finger	134..154	CDD:275368	9/19 (47%)
		zf-H2C2_2	147..171	CDD:290200	14/23 (61%)
		C2H2 Zn finger	162..182	CDD:275368	7/19 (37%)
		zf-H2C2_2	175..199	CDD:290200	12/23 (52%)
		C2H2 Zn finger	190..210	CDD:275368	7/19 (37%)
		zf-H2C2_2	202..227	CDD:290200	13/24 (54%)
		C2H2 Zn finger	218..238	CDD:275368	8/19 (42%)
		C2H2 Zn finger	243..262	CDD:275368
		zf-H2C2_2	255..279	CDD:290200
		C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	298..315	CDD:275368
		C2H2 Zn finger	326..346	CDD:275368
		C2H2 Zn finger	354..374	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910