Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021331195.1 | Gene: | si:ch211-162i8.2 / 100333435 | ZFINID: | ZDB-GENE-110913-56 | Length: | 1662 | Species: | Danio rerio |
Alignment Length: | 136 | Identity: | 63/136 - (46%) |
---|---|---|---|
Similarity: | 79/136 - (58%) | Gaps: | 0/136 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 185 KLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQ 249
Fly 250 RNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNL 314
Fly 315 VAHLQT 320 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |