Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002660733.3 | Gene: | LOC100332787 / 100332787 | -ID: | - | Length: | 356 | Species: | Danio rerio |
Alignment Length: | 241 | Identity: | 79/241 - (32%) |
---|---|---|---|
Similarity: | 112/241 - (46%) | Gaps: | 38/241 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 EQGVVKEVVQQTRPSTPPPIETEQLEPPED--EVLEEGVWSTEDPIEETPHGPAEKERPTVLTVE 161
Fly 162 MLPAPYPPPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHV 226
Fly 227 NYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYK 291
Fly 292 THTGEKPHICQLCNKSFARIHNLVAHLQTQQHI-NDPRLTAYLSTF 336 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
C2H2 Zn finger | 189..209 | CDD:275368 | 7/19 (37%) | ||
DUF45 | <204..281 | CDD:302795 | 31/76 (41%) | ||
COG5048 | 210..>345 | CDD:227381 | 50/128 (39%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 301..320 | CDD:275368 | 7/18 (39%) | ||
LOC100332787 | XP_002660733.3 | COG5048 | <77..314 | CDD:227381 | 68/199 (34%) |
C2H2 Zn finger | 102..122 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 114..139 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 130..150 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 158..178 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 170..195 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 186..206 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 214..234 | CDD:275368 | 7/23 (30%) | ||
zf-H2C2_2 | 226..249 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 242..262 | CDD:275368 | 1/3 (33%) | ||
C2H2 Zn finger | 270..290 | CDD:275368 | |||
zf-H2C2_2 | 282..306 | CDD:290200 | |||
C2H2 Zn finger | 298..318 | CDD:275368 | |||
zf-H2C2_2 | 310..335 | CDD:290200 | |||
C2H2 Zn finger | 326..344 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |