DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4424 and si:dkey-237m9.1

DIOPT Version :9

Sequence 1:	NP_650859.3	Gene:	CG4424 / 42390	FlyBaseID:	FBgn0038765	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	XP_017211095.1	Gene:	si:dkey-237m9.1 / 100329377	ZFINID:	ZDB-GENE-131118-30	Length:	359	Species:	Danio rerio

Alignment Length:	132	Identity:	60/132 - (45%)
Similarity:	76/132 - (57%)	Gaps:	0/132 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   187 HVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRN 251
            :.|..||..:.....|..|||.|.:||||.|..|.|||..|..|:.|:|.|||.|.:||..|.::
Zfish   161 YTCQQCGKSFYHAGNLIMHMRIHTEERPYSCPQCGKSFKQNGNLEVHMRTHTGEKRFTCTQCGKS 225

  Fly   252 FADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVA 316
            |..:.:|..|.|.|..|:||.|..|||.|||.|.||.|.:|||||.|..|..|.|||:...:|:.
Zfish   226 FVKKQNLDIHMRIHTGEKPYTCTECGKSFTYKSSLKHHMRTHTGENPFGCAQCEKSFSTKSSLMN 290

  Fly   317 HL 318
            |:
Zfish   291 HM 292

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4424	NP_650859.3	zf-AD	10..92	CDD:285071
		C2H2 Zn finger	189..209	CDD:275368	7/19 (37%)
		DUF45	<204..281	CDD:302795	36/76 (47%)
		COG5048	210..>345	CDD:227381	52/109 (48%)
		C2H2 Zn finger	217..237	CDD:275368	9/19 (47%)
		C2H2 Zn finger	245..265	CDD:275368	6/19 (32%)
		zf-H2C2_2	257..282	CDD:290200	12/24 (50%)
		C2H2 Zn finger	273..293	CDD:275368	11/19 (58%)
		zf-H2C2_2	286..310	CDD:290200	14/23 (61%)
		C2H2 Zn finger	301..320	CDD:275368	7/18 (39%)
si:dkey-237m9.1	XP_017211095.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910