Sequence 1: | NP_650859.3 | Gene: | CG4424 / 42390 | FlyBaseID: | FBgn0038765 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001108581.1 | Gene: | znf1147 / 100141494 | ZFINID: | ZDB-GENE-080218-13 | Length: | 260 | Species: | Danio rerio |
Alignment Length: | 227 | Identity: | 79/227 - (34%) |
---|---|---|---|
Similarity: | 112/227 - (49%) | Gaps: | 26/227 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 103 VKEVVQQTRPSTPPPIETEQLEPPEDE-VLEEGV---------WSTEDPIEETPHGPAEKERPTV 157
Fly 158 LTVEMLPAPYPPPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHK 222
Fly 223 SFHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLK 287
Fly 288 MHYKTHTGEKPHICQLCNKSFARIHNLVAHLQ 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4424 | NP_650859.3 | zf-AD | 10..92 | CDD:285071 | |
C2H2 Zn finger | 189..209 | CDD:275368 | 9/19 (47%) | ||
DUF45 | <204..281 | CDD:302795 | 35/76 (46%) | ||
COG5048 | 210..>345 | CDD:227381 | 48/110 (44%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 301..320 | CDD:275368 | 9/19 (47%) | ||
znf1147 | NP_001108581.1 | zf-C2H2 | 82..104 | CDD:278523 | 9/21 (43%) |
C2H2 Zn finger | 84..104 | CDD:275368 | 9/19 (47%) | ||
COG5048 | <86..257 | CDD:227381 | 57/129 (44%) | ||
zf-H2C2_2 | 96..121 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 112..132 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 125..149 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 140..160 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 152..177 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 168..188 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 180..205 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 196..216 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 208..230 | CDD:290200 | 3/7 (43%) | ||
C2H2 Zn finger | 224..244 | CDD:275368 | |||
zf-H2C2_2 | 236..259 | CDD:290200 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |