DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFAP4 and CG31832

DIOPT Version :9

Sequence 1:NP_001185624.1 Gene:MFAP4 / 4239 HGNCID:7035 Length:279 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:180 Identity:75/180 - (41%)
Similarity:104/180 - (57%) Gaps:7/180 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    98 TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENN 162
            |....|.|.|:|.:|||:|.:.|..||.|||..:||:::|||.::|:|.:|.:||.:.|:.....
  Fly    51 TTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGA 115

Human   163 TAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALS 227
            |.||.:.||.     |.:|.:.|.|...|...|.|||||.||..::|||||||.|...:||||..
  Fly   116 TVYAHFDDFQ-----VDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEH 175

Human   228 SGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIR 277
            .|.:||.||..::|||.|.........|||:|.:||  :.||...::.||
  Fly   176 GGGWWFHSCLSSSLNGLYFREGETGMLNGIHWGRWK--FQSLTFVQIMIR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFAP4NP_001185624.1 FReD 60..278 CDD:238040 75/180 (42%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/180 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.