DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4836 and D2063.1

DIOPT Version :10

Sequence 1:NP_001138085.1 Gene:CG4836 / 42387 FlyBaseID:FBgn0270925 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_001317740.1 Gene:D2063.1 / 183957 WormBaseID:WBGene00017060 Length:350 Species:Caenorhabditis elegans


Alignment Length:67 Identity:19/67 - (28%)
Similarity:30/67 - (44%) Gaps:12/67 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 KLEEKKLEESCNQPLTNGGGAAAGKSGSCVSLGDVGCLNGDLEEINTKEL---AHRISSELKRYS 485
            ::|:..:|.:...|     .||.||  ..|.|  ||..|...|.:|:..|   :.|:..:..:.|
 Worm    41 EVEDTAIESTARSP-----EAAGGK--MVVEL--VGAFNEVTERMNSVWLSTSSSRLLFKALKLS 96

  Fly   486 IP 487
            ||
 Worm    97 IP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4836NP_001138085.1 MDR 888..1218 CDD:450120
D2063.1NP_001317740.1 CAD3 10..348 CDD:176257 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.