DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED25 and PTOV1

DIOPT Version :9

Sequence 1:NP_650854.1 Gene:MED25 / 42385 FlyBaseID:FBgn0038760 Length:863 Species:Drosophila melanogaster
Sequence 2:XP_024307309.1 Gene:PTOV1 / 53635 HGNCID:9632 Length:455 Species:Homo sapiens


Alignment Length:483 Identity:115/483 - (23%)
Similarity:188/483 - (38%) Gaps:146/483 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 GMPMDTTPAQQQQQQQQQQQQQQQQGNPQQQVMNMNTMQQQQPGPNPPAGLLNPQQQQQLLQQQQ 327
            |.|:..||.:                      :......|..|.|..|||..:|.          
Human    27 GAPVPATPPE----------------------VVARASSQDSPAPERPAGPPSPH---------- 59

  Fly   328 QNQFVSNQMQNQNFQQNVGPGQNRWMYPNQPGQARPP--FMQGA---GNVGGVGQG------GGM 381
                                        :.|.:|..|  .::||   |.:|.:|..      ||:
Human    60 ----------------------------SAPARAPLPRAALEGARVFGALGPIGPSSPGLTLGGL 96

  Fly   382 ---QQNPNSALIS-------RINAPPPNQTVTSLQQQQQQQAQQQQQQQQQAQQQQQQR-MQMLS 435
               :...::.|::       :....|.:.:...|::....||...|.:..:..|..|:. ||::.
Human    97 AVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIP 161

  Fly   436 QQQMLNHQQLQQQQQLAQ-----QQQQQQQGQQQQQVNPNAG----------------------- 472
            ||.:.....|.:..||||     :.....:|..:...|..||                       
Human   162 QQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKK 226

  Fly   473 ---NNMMPASNAGNMSNPQQ----QQQQVGQ---QSNPQQQGNPQQQQQGNSQQEQASLREKIWT 527
               ..::|...:|.:|..:|    ::|.||.   .|.|.|..|.               :...|:
Human   227 KIFMGLIPYDQSGFVSAIRQVITTRKQAVGPGGVNSGPVQIVNN---------------KFLAWS 276

  Fly   528 GVLEWSEKPKSDQQKIPHTLQCTVCTNIKDGEPEIKAENWPPKLLMQLMPKHLVGNIGGQFLKDS 592
            ||:||.|.......:....|...|..|  .|| .::.|.||.||.|||:|:.|:..:...| ::|
Human   277 GVMEWQEPRPEPNSRSKRWLPSHVYVN--QGE-ILRTEQWPRKLYMQLIPQQLLTTLVPLF-RNS 337

  Fly   593 KMVVFRPTPG-EALDSLAKMMTSGYAGCVHFSSIPNSPACDLKVLILLYTPDRNAFLGFIPNNQA 656
            ::|.|..|.. |.|.||.::|.:|:|||||||   ...:|:::||:|||:.::..|:|.||::|.
Human   338 RLVQFHFTKDLETLKSLCRIMDNGFAGCVHFS---YKASCEIRVLMLLYSSEKKIFIGLIPHDQG 399

  Fly   657 MFVERLRKVI---QQKQHGNMQQQQQQQ 681
            .||..:|:||   ||....|::|:|||:
Human   400 NFVNGIRRVIANQQQVLQRNLEQEQQQR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED25NP_650854.1 Med25_VWA 4..218 CDD:288159
Med25 524..671 CDD:288130 57/150 (38%)
PTOV1XP_024307309.1 DNA_pol3_delta2 <1..156 CDD:331068 29/188 (15%)
Med25 108..253 CDD:314224 24/144 (17%)
Med25 273..414 CDD:314224 55/147 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142935
Domainoid 1 1.000 110 1.000 Domainoid score I6293
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004644
OrthoInspector 1 1.000 - - mtm8619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12433
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.