DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED25 and CG13609

DIOPT Version :9

Sequence 1:NP_650854.1 Gene:MED25 / 42385 FlyBaseID:FBgn0038760 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_651233.1 Gene:CG13609 / 42883 FlyBaseID:FBgn0039170 Length:364 Species:Drosophila melanogaster


Alignment Length:259 Identity:93/259 - (35%)
Similarity:141/259 - (54%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 QGNPQQQQQGNSQQEQASLREKIWTGVLEWSEKPKSDQQKIPHTLQCTVCTNIKDGEPEIKAENW 567
            |..|:..:.|:|       :|.||:|.|||.:....||.|..||:||.:|:.:|:|:|||..|||
  Fly    31 QKEPENPENGDS-------KETIWSGELEWEDAQILDQPKTLHTVQCKICSMVKEGQPEINTENW 88

  Fly   568 PPKLLMQLMPKHLVGNIGGQFLKDSKMVVFRPTPGEALDSLAKMMTSGYAGCVHFSSIPNSPACD 632
            |.||..||:||.::|.||.|||||::|||||.:.||.|:.|...|:||:|||:||   |::|.|:
  Fly    89 PNKLKTQLIPKKVLGKIGEQFLKDARMVVFRSSQGEVLNLLITAMSSGFAGCIHF---PSNPNCN 150

  Fly   633 LKVLILLYTPDRNAFLGFIPNNQAMFVERLRKVIQQKQHGNMQQQQQQQQMMQQQG-KSPMELQQ 696
            :|.|||:|:.|..|.:||||||:..|.|||::::|..:              ::.| |:|.:.|.
  Fly   151 IKALILIYSRDHQALVGFIPNNEDSFSERLQEILQGAK--------------RKPGVKTPKQPQP 201

  Fly   697 QQQQQQQQQ----------------QMQQDNSQQQHYNQFQLNMQMGGGGPGGGPGPGPGGMPM 744
            ::....::.                |...:.....|..:..:.:.:..|.||......|..|||
  Fly   202 EEPPPVEEDAIINELLWTGSLNWSTQASLEEPSISHKLECSVYIAIKNGDPGISAEDWPTDMPM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED25NP_650854.1 Med25_VWA 4..218 CDD:288159
Med25 524..671 CDD:288130 75/146 (51%)
CG13609NP_651233.1 Med25 45..189 CDD:288130 75/160 (47%)
Med25 216..358 CDD:288130 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458024
Domainoid 1 1.000 115 1.000 Domainoid score I5970
eggNOG 1 0.900 - - E1_28J9E
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004644
OrthoInspector 1 1.000 - - otm26484
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12433
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.