DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED25 and Ptov1

DIOPT Version :9

Sequence 1:NP_650854.1 Gene:MED25 / 42385 FlyBaseID:FBgn0038760 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_001008305.1 Gene:Ptov1 / 292888 RGDID:1306977 Length:416 Species:Rattus norvegicus


Alignment Length:409 Identity:108/409 - (26%)
Similarity:179/409 - (43%) Gaps:105/409 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 QPGQAR----PPFMQGA---GNVGGVGQG------GGMQQNPNSALISRINA-----------PP 397
            ||.:.|    || |:||   |.:|.:|..      ||:..|.: .|.:::.|           .|
  Rat    45 QPPRIRARSAPP-MEGARVFGALGPIGPSSPGLTLGGLAVNEH-RLSNKLLAWSGVLEWQEKRRP 107

  Fly   398 PNQTVTSLQQQQQQQAQQQQQQQQQAQQQQQQR-MQMLSQQQMLNHQQLQQQQQLAQ-----QQQ 456
            .:.:...|::....||...|.:..:..|..|:. ||::.||.:.....|.:..||||     :..
  Rat   108 FSDSAAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDC 172

  Fly   457 QQQQGQQQQQVNPNAG--------------------------NNMMPASNAGNMSNPQQ----QQ 491
            ...:|..:...|..||                          ..::|...:|.::..:|    ::
  Rat   173 DSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNAIRQVITTRK 237

  Fly   492 QQVGQ---QSNPQQQGNPQQQQQGNSQQEQASLREKIWTGVLEWSEKPKSDQQKIPHTLQCTVCT 553
            |.||.   .|.|.|..|.               :...|:||:||.|.......:....|...|..
  Rat   238 QAVGPGGVHSGPVQIVNN---------------KFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYV 287

  Fly   554 NIKDGEPEIKAENWPPKLLMQLMPKHLVGNIGGQFLKDSKMVVFRPTPG-EALDSLAKMMTSGYA 617
            |  .|| .::.:.||.:|.|||:|:.|:..:...| ::|::|.|..|.. |.|.||.::|.:|:|
  Rat   288 N--QGE-ILRTDQWPRRLFMQLIPQQLLTTLVPLF-RNSRLVQFHFTKDMETLKSLCRIMDNGFA 348

  Fly   618 GCVHFSSIPNSPACDLKVLILLYTPDRNAFLGFIPNNQAMFVERLRKVIQQKQHGNMQQQQQQQQ 682
            ||||||   ...:|:::||:|||:.::..|:|.||::|:.||..:|:||           ..|||
  Rat   349 GCVHFS---YKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVI-----------ANQQQ 399

  Fly   683 MMQQQGKSPMELQQQQQQQ 701
            ::|:      .|:|:|||:
  Rat   400 VLQR------SLEQEQQQR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED25NP_650854.1 Med25_VWA 4..218 CDD:288159
Med25 524..671 CDD:288130 53/147 (36%)
Ptov1NP_001008305.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 3/7 (43%)
Med25 93..238 CDD:288130 24/144 (17%)
Interaction with FLOT1. /evidence=ECO:0000250 184..416 75/268 (28%)
Med25 258..399 CDD:288130 54/158 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336636
Domainoid 1 1.000 110 1.000 Domainoid score I6158
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004644
OrthoInspector 1 1.000 - - mtm9099
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12433
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.