DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED25 and Ptov1

DIOPT Version :10

Sequence 1:NP_650854.1 Gene:MED25 / 42385 FlyBaseID:FBgn0038760 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_001008305.1 Gene:Ptov1 / 292888 RGDID:1306977 Length:416 Species:Rattus norvegicus


Alignment Length:409 Identity:108/409 - (26%)
Similarity:179/409 - (43%) Gaps:105/409 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 QPGQAR----PPFMQGA---GNVGGVGQG------GGMQQNPNSALISRINA-----------PP 397
            ||.:.|    || |:||   |.:|.:|..      ||:..|.: .|.:::.|           .|
  Rat    45 QPPRIRARSAPP-MEGARVFGALGPIGPSSPGLTLGGLAVNEH-RLSNKLLAWSGVLEWQEKRRP 107

  Fly   398 PNQTVTSLQQQQQQQAQQQQQQQQQAQQQQQQR-MQMLSQQQMLNHQQLQQQQQLAQ-----QQQ 456
            .:.:...|::....||...|.:..:..|..|:. ||::.||.:.....|.:..||||     :..
  Rat   108 FSDSAAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDC 172

  Fly   457 QQQQGQQQQQVNPNAG--------------------------NNMMPASNAGNMSNPQQ----QQ 491
            ...:|..:...|..||                          ..::|...:|.::..:|    ::
  Rat   173 DSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNAIRQVITTRK 237

  Fly   492 QQVGQ---QSNPQQQGNPQQQQQGNSQQEQASLREKIWTGVLEWSEKPKSDQQKIPHTLQCTVCT 553
            |.||.   .|.|.|..|.               :...|:||:||.|.......:....|...|..
  Rat   238 QAVGPGGVHSGPVQIVNN---------------KFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYV 287

  Fly   554 NIKDGEPEIKAENWPPKLLMQLMPKHLVGNIGGQFLKDSKMVVFRPTPG-EALDSLAKMMTSGYA 617
            |  .|| .::.:.||.:|.|||:|:.|:..:...| ::|::|.|..|.. |.|.||.::|.:|:|
  Rat   288 N--QGE-ILRTDQWPRRLFMQLIPQQLLTTLVPLF-RNSRLVQFHFTKDMETLKSLCRIMDNGFA 348

  Fly   618 GCVHFSSIPNSPACDLKVLILLYTPDRNAFLGFIPNNQAMFVERLRKVIQQKQHGNMQQQQQQQQ 682
            ||||||   ...:|:::||:|||:.::..|:|.||::|:.||..:|:||           ..|||
  Rat   349 GCVHFS---YKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVI-----------ANQQQ 399

  Fly   683 MMQQQGKSPMELQQQQQQQ 701
            ::|:      .|:|:|||:
  Rat   400 VLQR------SLEQEQQQR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED25NP_650854.1 Med25_VWA 5..218 CDD:463253
Med25 520..671 CDD:463243 53/151 (35%)
Ptov1NP_001008305.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 3/7 (43%)
Med25 89..238 CDD:463243 24/148 (16%)
Interaction with FLOT1. /evidence=ECO:0000250 184..416 75/268 (28%)
Med25 254..399 CDD:463243 55/177 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.