DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31213 and Abcg1

DIOPT Version :9

Sequence 1:NP_001262752.1 Gene:CG31213 / 42382 FlyBaseID:FBgn0051213 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_445954.2 Gene:Abcg1 / 85264 RGDID:620294 Length:666 Species:Rattus norvegicus


Alignment Length:432 Identity:90/432 - (20%)
Similarity:156/432 - (36%) Gaps:147/432 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 IGIEVRSLS---------KTFGFRNVVKDLFFNVYENEITALVGHKGSGKTTIIMMLCGILQP-T 543
            :.||.:.||         :..|::.::|.:.......|:.|::|..|:||:|::.:|.|..:. .
  Rat    75 VNIEFKDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGM 139

  Fly   544 TGTVLINGY--DIVTEAKVAKSSLGIC--PQHSVIFKGMSARDHIYFFSRVKGYNKTEAMMES-N 603
            .|.|||||.  |:....||:      |  .|..::...::.::.:...:.:|...|.|...|. .
  Rat   140 KGAVLINGMPRDLRCFRKVS------CYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVK 198

  Fly   604 IYISKLGLVDSQKWDAMRLSPGNQRRLSLACALCAGSKVILCDEPSSGLDPIGRHELMRFLQ-KE 667
            ..::.|||:.........||.|.::||::|..|.....|:..|||:||||.....:::..:: ..
  Rat   199 EILTALGLLPCANTRTGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKGLA 263

  Fly   668 KHGRTILMTTQQ----LEEGEILADRIAIMNDGQILCYGTLG----YLKQLPFTSYTLSCQMAPN 724
            :.||:|:.|..|    |.|   |.|::.:::.||.:..|.:.    ||:.|     .|:|     
  Rat   264 QGGRSIVCTIHQPSAKLFE---LFDQLYVLSQGQCVYRGKVSNLVPYLRDL-----GLNC----- 315

  Fly   725 SKADNLTDLVRLYMTTTTSPVFHGVDVSYKLPRSQIDRFPEFFQQLEENKKSLNVVSFGVSDSTL 789
                               |.:|                              |...|.:.    
  Rat   316 -------------------PTYH------------------------------NPADFVME---- 327

  Fly   790 DGIYLSLDYGQGSSRLRGGADPGVND---KVEFGVQTDKAIRTKDRANNSLVRYQHQVDPPNETI 851
               ..|.:||..:|||......|:.|   |.|.|...|                           
  Rat   328 ---VASGEYGDQNSRLVRAVREGMCDSDYKRELGGDGD--------------------------- 362

  Fly   852 LNTKTPINPIEIW-RPIDRE----------KGSCMAQWQAMF 882
                  :||. :| ||.:.:          ..||:.|:..:|
  Rat   363 ------VNPF-LWHRPAEEDSASMEGCHSFSASCLTQFCILF 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31213NP_001262752.1 ABC2_membrane_3 32..>295 CDD:289468
ABC_subfamily_A 491..708 CDD:213230 61/240 (25%)
drrA 498..796 CDD:130256 65/312 (21%)
ABC2_membrane_3 <1132..1285 CDD:289468
CcmA 1391..1672 CDD:224054
ABC_subfamily_A 1391..1609 CDD:213230
Abcg1NP_445954.2 3a01204 60..666 CDD:273361 90/432 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.