DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31213 and abcg4b

DIOPT Version :9

Sequence 1:NP_001262752.1 Gene:CG31213 / 42382 FlyBaseID:FBgn0051213 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_001104682.1 Gene:abcg4b / 794238 ZFINID:ZDB-GENE-080215-10 Length:644 Species:Danio rerio


Alignment Length:274 Identity:63/274 - (22%)
Similarity:128/274 - (46%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 GNLPAAHPTRQPIIYLDDRTQENFQRVNISKK--IGIEVRSLSKTF---------GFRNVVKDLF 510
            |:.|...|....:..:::...|..:..::.|:  :.:|.:.|..|.         |::.::|.|.
Zfish    23 GSQPQEAPLLTHLKKVENHITEAQRFSHLPKRTTVELEFKELCYTIREGPWWKKQGYKALLKCLS 87

  Fly   511 FNVYENEITALVGHKGSGKTTIIMMLCGILQP-TTGTVLINGYDIVTEAKVAKSSLGICPQHSVI 574
            ......|:..::|..|:||:|::.:|.|..:. .||.:|:||.  :.:.:..:.......|...:
Zfish    88 GKFSSRELIGIMGPSGAGKSTLMNILAGYRETGMTGQILVNGK--LRDPRTFRKMSCYIMQEDKL 150

  Fly   575 FKGMSARDHIYFFSRVKGYNKTEAMME-SNIYISKLGLVDSQKWDAMRLSPGNQRRLSLACALCA 638
            ...:|.::.:...:.:|....:|...| ....::.|||.:......:.||.|..:||::|..|..
Zfish   151 LPHLSVQEAMMVSANLKLNESSEVKKELIKEILTALGLHECVHTRTVSLSGGQCKRLAIALELVN 215

  Fly   639 GSKVILCDEPSSGLDPIGRHELMRFLQK-EKHGRTILMTTQQ----LEEGEILADRIAIMNDGQI 698
            ...|:..|||:||||.....:::..::. .:.||||:.|..|    |.|   :.|::.|::.||.
Zfish   216 NPPVMFFDEPTSGLDSASCFQVVSLMKSLAQGGRTIICTIHQPSAKLFE---MFDKLYILSQGQC 277

  Fly   699 LCYGTLGYLKQLPF 712
            :..|::.||  :|:
Zfish   278 IYKGSVPYL--IPY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31213NP_001262752.1 ABC2_membrane_3 32..>295 CDD:289468
ABC_subfamily_A 491..708 CDD:213230 56/232 (24%)
drrA 498..796 CDD:130256 56/231 (24%)
ABC2_membrane_3 <1132..1285 CDD:289468
CcmA 1391..1672 CDD:224054
ABC_subfamily_A 1391..1609 CDD:213230
abcg4bNP_001104682.1 3a01204 42..644 CDD:273361 60/255 (24%)
ABCG_EPDR 57..281 CDD:213180 54/228 (24%)
ABC2_membrane 375..574 CDD:279410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.