DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31213 and abcg5

DIOPT Version :9

Sequence 1:NP_001262752.1 Gene:CG31213 / 42382 FlyBaseID:FBgn0051213 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_001122162.1 Gene:abcg5 / 557317 ZFINID:ZDB-GENE-050517-40 Length:652 Species:Danio rerio


Alignment Length:356 Identity:79/356 - (22%)
Similarity:136/356 - (38%) Gaps:72/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1410 VSFAIRPGDTFGLLGAQGAGKTSIFQMIAGETSMS---HGNIYVRGHSLREHRNAAKMEVGFCPQ 1471
            |||.:..|...|:||..|:|||::...|||....|   .|.::|.|..|:  |...:....:..|
Zfish    76 VSFHLDSGQIMGILGNSGSGKTTLLDAIAGRIGNSGNLQGEVFVNGRKLK--REQFQDCFSYVLQ 138

  Fly  1472 GDNAPKYLTGRQLLRIHCLL----HGVP--KDHIKAVSEQMAIEFNFKDQLDRPIHT-------- 1522
            .||...|||..:.|.....|    |...  :..:.||..:::        |....|:        
Zfish   139 SDNLLSYLTVEETLTYTAQLALRKHSAEAIRKKVTAVMAELS--------LGHVAHSVIGGRVFP 195

  Fly  1523 -YSGGKKRKLNIA-LAIDSGSVLCLDDTNGSVDHATQRFIWRKLEAVKRSGRPVLLTT-QSMEEA 1584
             .|||::|:::|| ..:....|:.||:....:|..|...|...|..:.|..|.|::|. |...|.
Zfish   196 GISGGERRRVSIASQLLQDPKVILLDEPTTGLDSMTANQIVMLLAELARRDRIVIVTIHQPRSEL 260

  Fly  1585 NAVCSRVAFLVAGEMMFIGSLQQVRSEVSNTIVIRLRVNPSDGKLKRRFQQLIADMAELFPLATL 1649
            ..:.:|:|.:..||::|.|...:                                |.:.|. :..
Zfish   261 FRIFNRIAIMSQGELVFCGEPHK--------------------------------MVDFFS-SCG 292

  Fly  1650 HEALETCLIYHININVTTLANLFYQMEKIRNEGLLEDYSITQVSLDEIYRILNDE-------EDP 1707
            :|..|.|..:.|.:::|::.....:.|......:.:..|..|.|  |||..:.::       .|.
Zfish   293 YECPEYCNPFDIYVDLTSVDTRCSEREAATYRRMHDITSAYQNS--EIYTNMQEKIEQSCQRPDK 355

  Fly  1708 NLVDLDSTHNSEVLEDIRDTTRDTTRGTTRD 1738
            .::...|..:...:..:....|.|.|..:||
Zfish   356 PMIPFKSKESPNCISKLGVLLRRTFRNVSRD 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31213NP_001262752.1 ABC2_membrane_3 32..>295 CDD:289468
ABC_subfamily_A 491..708 CDD:213230
drrA 498..796 CDD:130256
ABC2_membrane_3 <1132..1285 CDD:289468
CcmA 1391..1672 CDD:224054 65/281 (23%)
ABC_subfamily_A 1391..1609 CDD:213230 58/218 (27%)
abcg5NP_001122162.1 3a01204 50..645 CDD:273361 79/356 (22%)
ABCG_White 53..279 CDD:213201 57/212 (27%)
ABC2_membrane 375..582 CDD:279410 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.