DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs6st and HS6ST2

DIOPT Version :9

Sequence 1:NP_001262750.1 Gene:Hs6st / 42380 FlyBaseID:FBgn0038755 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001070656.1 Gene:HS6ST2 / 90161 HGNCID:19133 Length:645 Species:Homo sapiens


Alignment Length:340 Identity:172/340 - (50%)
Similarity:224/340 - (65%) Gaps:50/340 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 FDMDGHDVMVFLHIQKTGGTSFGRHLVRDLDLKRPCECQRQRKRCYCFRPHRNENWLFSRYSTGW 205
            ||:.|.|::|||||||||||:|||||||::.|::||||:..:|:|.|.||.:.|.|||||:||||
Human   221 FDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGW 285

  Fly   206 KCGLHADWTELTSCV--------DVEL----------------DK------NEG----------E 230
            .||||||||||||||        |..|                ||      |.|          .
Human   286 SCGLHADWTELTSCVPSVVDGKRDARLRPSRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRN 350

  Fly   231 TAK--RRYFYISLLRQPIARYMSEYRHVRRGATWKGSRHWCLGRQATAAELPACYKGKDWLDVDL 293
            |:|  :.:.||::||.|::||:||:|||:||||||.|.|.|.||..|:.|||:||.|.||....|
Human   351 TSKSGKNFHYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPL 415

  Fly   294 DQFAGCESNLAANRQTRMLADLALVGCYNKSSMPAHERDRVMLASAKRNLAAMAYFGLTEYQKMS 358
            .:|..|..|||.|||.|||:||.||||||.|.||..:|::|:|.|||.||..||:|||||:|:.:
Human   416 KEFMDCPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKT 480

  Fly   359 QYIFEETFNLRFAIPFEQHNTTISATAVQNLRPDQKRRIEKLNSLDIELYAFAKTLLFQRF---- 419
            ||:||:|||:.|..||.|:||| .|::|: :..:.::|||.||.||:|||::||.|..||:    
Human   481 QYLFEKTFNMNFISPFTQYNTT-RASSVE-INEEIQKRIEGLNFLDMELYSYAKDLFLQRYQFMR 543

  Fly   420 --EHLKAKDTNFEQR 432
              ||.:|:....|||
Human   544 QKEHQEARRKRQEQR 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs6stNP_001262750.1 Sulfotransfer_2 144..410 CDD:281554 159/307 (52%)
HS6ST2NP_001070656.1 Sulfotransfer_2 225..530 CDD:281554 159/306 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159740
Domainoid 1 1.000 335 1.000 Domainoid score I1128
eggNOG 1 0.900 - - E1_KOG3955
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 344 1.000 Inparanoid score I2325
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1167623at2759
OrthoFinder 1 1.000 - - FOG0001176
OrthoInspector 1 1.000 - - otm40733
orthoMCL 1 0.900 - - OOG6_104471
Panther 1 1.100 - - LDO PTHR12812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1002
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.