DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs6st and TPST

DIOPT Version :9

Sequence 1:NP_001262750.1 Gene:Hs6st / 42380 FlyBaseID:FBgn0038755 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001320287.1 Gene:TPST / 837318 AraportID:AT1G08030 Length:500 Species:Arabidopsis thaliana


Alignment Length:437 Identity:91/437 - (20%)
Similarity:142/437 - (32%) Gaps:171/437 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ANAGLSYEDVLNDDFQFDMDGHDVMVFLHIQKTGGTSFGRHLVRDL-DLKRPCECQRQRKRCYCF 188
            |::..|.|:.:|.|   .....|::.|||:.:|||.::....:|.| |...  ||.|...:.: |
plant    39 ADSSSSREEHVNKD---KRSLKDLLFFLHVPRTGGRTYFHCFLRKLYDSSE--ECPRSYDKLH-F 97

  Fly   189 RPHRNENWLFSRYSTGWKCGL---HADWTELTSCVDVELDKNEGETAKRRYFYISLLRQPIARYM 250
            .|.:.            ||.|   |.|::.:            .:..:.|...::::|.||||.:
plant    98 NPRKE------------KCKLLATHDDYSLM------------AKLPRERTSVMTIVRDPIARVL 138

  Fly   251 SEYR-----------------------HVRRGAT--------WKGSRHWC---LGRQATAAELPA 281
            |.|.                       .:|:...        ||....|.   |..:..|.:|..
plant   139 STYEFSVEVAARFLVHPNLTSASRMSSRIRKSNVISTLDIWPWKYLVPWMREDLFARRDARKLKE 203

  Fly   282 CYKGKDWLDVDLDQF---------AGCESNLAANRQTRMLADLALVGCYNKSSM-PAHE-RDRV- 334
            ....:|....|:::.         |....::..|..|..:|     |..|.|.: .||| |..| 
plant   204 VVIIEDDNPYDMEEMLMPLHKYLDAPTAHDIIHNGATFQIA-----GLTNNSHLSEAHEVRHCVQ 263

  Fly   335 --------MLASAKRNLAAMAYFGLTEYQKMSQYIFEETFN---LRFAIPF----------EQHN 378
                    :|..|||.|.:|.|.||||..:.|..:|.....   |...:|.          .:.:
plant   264 KFKSLGESVLQVAKRRLDSMLYVGLTEEHRESASLFANVVGSQVLSQVVPSNATAKIKALKSEAS 328

  Fly   379 TTISATA-----VQN--------------------------------LRPDQKRR---------- 396
            .|||.|.     :||                                ||..|..|          
plant   329 VTISETGSDKSNIQNGTSEVTLNKAEAKSGNMTVKTLMEVYEGCITHLRKSQGTRRVNSLKRITP 393

  Fly   397 ------------------IEKLNSLDIELYAFAKTLLFQRFEHLKAK 425
                              |:.||:||:|||.:||.:..:..|.:..|
plant   394 ANFTRGTRTRVPKEVIQQIKSLNNLDVELYKYAKVIFAKEHELVSNK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs6stNP_001262750.1 Sulfotransfer_2 144..410 CDD:281554 82/401 (20%)
TPSTNP_001320287.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I2550
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1167623at2759
OrthoFinder 1 1.000 - - FOG0001176
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12812
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.