DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4459 and CG3168

DIOPT Version :9

Sequence 1:NP_650850.1 Gene:CG4459 / 42377 FlyBaseID:FBgn0038753 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001284957.1 Gene:CG3168 / 31612 FlyBaseID:FBgn0029896 Length:632 Species:Drosophila melanogaster


Alignment Length:403 Identity:65/403 - (16%)
Similarity:146/403 - (36%) Gaps:95/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LGALIGGLMAYSALKKISPRRLMLLGMIGQIFCGNLTGLVDTYQLHIYFRCLTSIFCALMYTSGQ 238
            :|.::|.....|.......::::::......||...:....||...:.||.|..   |.:..||.
  Fly   198 IGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNG---AALGGSGP 259

  Fly   239 FILN---DITSGKARIIVVTLSELFWSMGLVLLPAIS--------------IYFDNWSYLYVAIS 286
            .|.:   :......|..:::....||:.|.:.:.:::              ..:::|....:..|
  Fly   260 VIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCS 324

  Fly   287 SSLIVLVWLHRWIADAPRWLLQHQRVEAALRQLLESATYNNRKVP-------LTLDVQLTMYAND 344
            ....::.:|..::.::|::||...:.:.||.........|.::.|       |.:|.:|      
  Fly   325 LPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEKL------ 383

  Fly   345 LDQKSKQKHSYCQVWDGETKRSQLVY-----------------IHLIWGGAMV----LYN----- 383
            |:.....|:.|.::..|....|:.::                 .|:.:.|.::    |:|     
  Fly   384 LESNGNVKNKYSRMISGMVDHSRALFKSPILRFTIVSITINFTFHIGYYGLLMWFPELFNRFEEY 448

  Fly   384 ------------IILLMIRNLGAQQVHVNTAAMGFAEMV--------------GLFVGLYLILYT 422
                        .:...:.||..:|.:..|.:....:.|              .|...|.:.:..
  Fly   449 EKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLASALPANLLAILGMDMLG 513

  Fly   423 RRHWRWAGNLMIIAGLSTYLIWLLPETERNSRRVGLELVFWLILKIANSASIAVLTTCTSEIVSK 487
            |:.:..||.:  .||:.:.|::.:..:.:|       ||...|...|.||:.|.|....:|:...
  Fly   514 RKFFLIAGTM--TAGICSALMYFVRSSVQN-------LVVSAIFSGAISAANAALDCLITEVFPT 569

  Fly   488 EKRVV-LMLSVIS 499
            :.|.. :.:|:::
  Fly   570 KLRATGVAISMVA 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4459NP_650850.1 2A0119 26..536 CDD:273328 65/403 (16%)
MFS 164..540 CDD:119392 65/403 (16%)
CG3168NP_001284957.1 2A0115 149..598 CDD:273327 65/403 (16%)
MFS 154..623 CDD:119392 65/403 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.