DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4459 and CG33233

DIOPT Version :9

Sequence 1:NP_650850.1 Gene:CG4459 / 42377 FlyBaseID:FBgn0038753 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:465 Identity:85/465 - (18%)
Similarity:174/465 - (37%) Gaps:140/465 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QFDLICSRRVLVALTQSFHALGALIGGLMAYSAL------KKISPRRLMLLGMIGQIFCGNLTGL 212
            :||.....:.|:|        .:|:||::| |.|      .:...:.::.|.::|.:....::.|
  Fly    50 EFDTSPKEKTLLA--------NSLLGGMVA-SGLFIGFLADRYGRKFVIRLALVGALSFSVISAL 105

  Fly   213 V-DTYQLHIYFRCLTSIFCALMYTSGQFILNDITSGKARIIVVTLSELFWSMGLVLLP--AISIY 274
            : |.|.|.: .|.:...|.:.:.:.....|.:..:.|.|.|.|.:......:.|:..|  |::|.
  Fly   106 MPDLYSLSV-IRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAIL 169

  Fly   275 FDNWSYLYVAISSSLIVLVW--------LHRWIA--------DAPRWLLQHQRVEAALRQLLESA 323
            .:|::   |.:|||..:.||        :..|:|        :.|.:|:...|.:.||..|....
  Fly   170 PNNFN---VDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWIC 231

  Fly   324 TYNNRKVPLTLDVQLTMYANDLDQKSKQKHSYCQVWDGETKRSQLVY-----------IHLIWGG 377
            ..|.:|..   ||.:|: :.:....:.|:..:..||    ...:|::           :.||:| 
  Fly   232 RMNRKKWE---DVDITL-SEEKSSTNDQEGFWKTVW----YEYKLLFSKPHVFKFFICLFLIFG- 287

  Fly   378 AMVLYNIILL-----MIRNL---GAQQ----VHVNTAAMGFA----------------EMVGL-- 412
              :.:..|.|     :|||:   |:.:    |:.|...:...                ||..|  
  Fly   288 --IFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLID 350

  Fly   413 -------FVGLYLILYTRRHWRW-----AGNLMI--IAGLSTYLIWLLPETERNSRRVGLELVFW 463
                   ::|.:::.....||..     |.:::|  |.|:|..::          ::..:.|:|:
  Fly   351 PVYYGFTYIGCFILASVLVHWMTRKYVIALHILISMILGISLNIM----------KQPTVVLIFF 405

  Fly   464 LILKIANSASIAVLTTCTSEIVSKEKRVVLMLSVISFSR-------------------------- 502
            :::.:.....|.:.|:...:.:....|...:..|.|.:|                          
  Fly   406 VLMMVLPGVLIPLATSVLVDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFN 470

  Fly   503 VCLLFCPFLS 512
            :||..|..|:
  Fly   471 LCLAICVVLA 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4459NP_650850.1 2A0119 26..536 CDD:273328 85/465 (18%)
MFS 164..540 CDD:119392 83/455 (18%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 81/434 (19%)
MFS 23..>208 CDD:119392 36/170 (21%)
MFS 354..>482 CDD:304372 20/137 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.