DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4459 and T05A1.5

DIOPT Version :9

Sequence 1:NP_650850.1 Gene:CG4459 / 42377 FlyBaseID:FBgn0038753 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:232 Identity:43/232 - (18%)
Similarity:97/232 - (41%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 CEHVEHRTDY---KSLISQFDLICSRRVLVALTQSFHALG-ALIGGLMAYSALKKISPRRLMLLG 199
            |..|..:.::   |:||...:          :|.|...|| .::|.:.|.:| .:|..|.:    
 Worm   118 CSFVTVQNEFNITKTLIDPGE----------MTSSIFFLGNGILGQIYAVAA-DRIGRRPV---- 167

  Fly   200 MIGQIFCGNLTGL----VDTYQLHIYFR-----CLTSI-------FCALMYTSGQFILNDITSGK 248
            :|..:|...|:|:    ..|:::.:..|     |.|::       .|..:..||.        |.
 Worm   168 LIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCFTALTMINWVMCCESISFSGH--------GY 224

  Fly   249 ARIIVVTLSELFWSMGLVLLPAISIYFDNWSYLYVAISSSLIVL-VWLHRWIADAPRWLLQHQRV 312
            |.:    |..|.|.:|...:..:::||..|.|:.:|.|...::. :.:...:.::..:|:..::.
 Worm   225 ASV----LFGLCWVIGYCSVSPLAMYFSTWRYVQLATSVPCVLFGILMMFTLPESFSFLVAKRKR 285

  Fly   313 EAALRQLLESATYNNRKVPLTLDVQLTMYANDLDQKS 349
            :..::.:..::...|.::....|..:.|.:.:.|.:|
 Worm   286 DDLVKWIEMASRVGNEEIDYDADQIVDMSSREEDNES 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4459NP_650850.1 2A0119 26..536 CDD:273328 43/232 (19%)
MFS 164..540 CDD:119392 38/204 (19%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 37/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.