DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4459 and Ust5r

DIOPT Version :9

Sequence 1:NP_650850.1 Gene:CG4459 / 42377 FlyBaseID:FBgn0038753 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_599207.2 Gene:Ust5r / 171398 RGDID:620985 Length:552 Species:Rattus norvegicus


Alignment Length:539 Identity:102/539 - (18%)
Similarity:207/539 - (38%) Gaps:131/539 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DVVEQVNGSFGRWQLRTILLIFLCKIPSAWFTAIIIYTAPYP----WKGELVCHPADWNVSRSQT 79
            :::.|| ||.||:|:..:..:||..:.....:.|..:||..|    |.      |...||:    
  Rat     5 ELLNQV-GSLGRFQILQMAFVFLINVSVVPHSTIENFTAAIPSHRCWV------PILDNVT---- 58

  Fly    80 EHVDRNHP--LWQD-----ARSTDRLFNVDVCNAYSNSLARGFVRSHGQEWNASQSKEPGGQSSL 137
              |..||.  |.||     :...|....:|.|..::..      :.|..:.|.:.|......:. 
  Rat    59 --VSDNHSRILNQDKLLKISIPLDSHLRLDKCRRFAQP------QWHLLDLNDTFSSVTEADTE- 114

  Fly   138 PCEH--VEHRTDYKS-LISQFDLICSRRVLVALTQSFHALGALIGGLMAYSALKKISPRRLMLLG 199
            ||..  |..|:::.| .::::||:|..:||.::|:....:||.|||::......:...:.::...
  Rat   115 PCVDGWVYDRSNFHSTTVTEWDLVCESQVLNSVTKFSFMIGAFIGGIVNGPLSDRFGRKFVLKCA 179

  Fly   200 MIGQIFCGNLTGLVDTYQLHIYFRCLTSIFCALMYTSGQFILNDITSGKARIIVVTLSELFWSMG 264
            ::.........|....:.::...|.|..:....:..:...::.:.||.|...::..::....|.|
  Rat   180 LLQMAITETCVGFASNFFIYCSLRFLAGMTFEPILVNSNLLMFEWTSHKFLAMMSVIAPCAGSFG 244

  Fly   265 LVLLPAISIYFDNWSYLYVAISSSLIVLVWLHRWIADAPRWLLQHQRVEAALRQLLESATYNNRK 329
            .::|..::..|.||.:|.:|:|..:...:.|.||::::.|||:...:.:..|::|.:.|..|..|
  Rat   245 SMILAGLAFQFQNWHHLQLAMSVPIFFFLILTRWLSESARWLIVTNKPQKGLKELRKVAHMNGMK 309

  Fly   330 VP---LTLDVQLTMYANDLDQKSKQKHSYCQVWDGETKR-------------------------- 365
            ..   ||::|..|....:| :.:|.:.|...::.....|                          
  Rat   310 NSGDNLTMEVVRTSMKREL-EAAKARPSPRDLFHTPILRKRICAMSFMRILFMLSIFGMSLHLQH 373

  Fly   366 --SQLVYIHLIWGGAMVLYNII----------------LLMIRNL-------------------- 392
              |.::.:..:...:.:|:::|                ::.:|.:                    
  Rat   374 LSSNIMLLQFVVSASSLLFSVIGPYVFNRMGRRITQMVVMTLRGICILTAVFVPQEMQILRITVV 438

  Fly   393 -----------GAQQVHVN--------TAAMGFAEMVG----LFVGLYLILYT---RRHWRWAGN 431
                       |..::|.|        ..|:|...|.|    ....|::||.:   ...|.:.|.
  Rat   439 TLAGAFSALSFGVNRLHTNELLPTTLRATAIGVIGMFGNSGFFLAPLFMILASYSPNLPWIFYGG 503

  Fly   432 LMIIAGLSTYLIWLLPETE 450
            ..|:.|   :.::|||||:
  Rat   504 FSILNG---FTVFLLPETK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4459NP_650850.1 2A0119 26..536 CDD:273328 100/532 (19%)
MFS 164..540 CDD:119392 64/380 (17%)
Ust5rNP_599207.2 MFS_OAT 109..516 CDD:340932 69/411 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.